SKU: 97418107775

GABARAPL2 His Tag Protein, Human

Sale price$182.70 Regular price$203.00
Save 10%

Pay in installments of $50.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GABARAPL2 His Tag Protein, HumanProduct Specification Species Human Synonyms ATG8L, ATG8C, GATE 16, GATE16, GEF 2, GEF2 Accession P60520 Amino Acid Sequence Met1 Phe117, with N terminal 8*His Tag MHHHHHHHHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF. Expression System E. coli Molecular Weight 17kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms ATG8L, ATG8C, GATE-16, GATE16, GEF-2, GEF2
Accession P60520
Amino Acid Sequence

Met1-Phe117, with N-terminal 8*His Tag MHHHHHHHHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF.

Expression System E.coli
Molecular Weight 17kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Ewing Rob M, et al. (2007) Large-scale mapping of human protein-protein interactions by mass spectrometry. Mol Syst Biol. 3(1):89. 2. Okazaki N, et al. (2000) Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain: possible role of vesicular transport in axonal elongation. Brain Res Mol Brain Res. 85(1-2):1-12. 3. Xin Y, et al. (2001) Cloning, expression patterns, and chromosome localization of three human and two mouse homologues of GABA(A) receptor-associated protein. Genomics. 74 (3):408-13.

Background

GATE-16, also known as ATG8, belongs to the MAP1 LC3 family. It is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle. GATE-16 is expressed at very low levels in lung, thymus and small intestine. GATE-16 is involved in intra-Golgi traffic. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97418107775

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Madisyn
Houston, US
★★★★★ 5
Amazing mitt!!
Pattern Name: 1 Tanning Mitt, Pattern Name: 1 Tanning Mitt
i’ve been self tanning for years and no other method has performed as well as this mitt has. it’s incredible. i’ve tried using my hands, which leaves them orange and my body streaky. i’ve used the tanning mitts that you can find at drug stores and at ULTA, and they always tend to rip on the sides after a few uses. although those ones left my tan not as streaky, they’re nothing compared to the sun laboratories mitts. they’re extremely soft and long lasting. i can use this mitt to apply any self tanner so evenly and streak free. i’ve never been more impressed with any other self tanning mitt than i am with this one. in just a few minutes this mitt gives me a smooth, flawless, bronzer finish. it’s distributed the same all over. i’ve even used this mitt to apply self tanner to my face and it works perfectly. i thought all mitts worked the same until i came across this one. the sun laboratories self tanner is incredible as well. these are by far the best combination i’ve ever used and i definitely recommend everyone to try, especially if you’re having a hard time finding a self tanner that performs well and applies evenly, while looking natural rather than artificial.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2018
S
Verified Purchase
Southernmermaid85
Lexington, US
★★★★★ 4
Good mit.
Pattern Name: 1 Tanning Mitt
It's that time of year where you start to need a tan. Since I'm not out in the sun much I totally rely on fake and bake. I needed a mitt that would easily apply sunless tanner. The Smith is soft and it does help the product go on nicely. However if you apply too much sunless tanner to the MIT it will soak through and without you knowing it you will have bronze to Orange Palms so just make sure you wash your hands thoroughly. It is definitely not the best MIT in the world but it's also not the worst. I would in fact purchase this again. But remember with also painters you must exfoliate exfoliate and prep the skin before applying it otherwise you will come out looking like a bright orange Sun. That is from personal experience.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2020
D
Verified Purchase
Dominique
Belleville, US
★★★★★ 5
Awesome self tanning mitt!
Pattern Name: 1 Tanning Mitt, Pattern Name: 1 Tanning Mitt
This self tanning lotion mitt is amazing! It works wonders when applying the self tanning lotion. It rubs all the product evenly into your skin. The mitt does not soak up the self tanner lotion like I was afraid it would. The mitt does not leave you with streaks or any imperfections. The self tanning mitt is also very soft and flexible which helps when applying product. The tanning mitt has almost a fleece, velvety, plush texture. VERY SOFT! Very easy to work with! I used a self tanning mitt and also tried applying self tanner with my bare hands, and with latex gloves and found the tanning mitt is the easiest to use and work with. Disposable gloves seemed impossible to work with and I felt like it wasn’t rubbing the product in easy but this mitt is a life savor! If you are a fan of self tanning products weather it’s a spray, lotion, mousse, you need to have a tanning mitt in your collection! You will thank me and the tanning people for this product! It’s truly AMAZING! The self tanning mitt comes with the Black mitt, and disposable gloves. I’ll definitely be using the tanning mitt when applying the sunlabs self tanning products!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2018
C
Verified Purchase
Christine
Phoenix, US
★★★★★ 5
Reliable!
Pattern Name: 1 Tanning Mitt
I don't normally use self-tanner, but having a mitt does make me more likely to, since it makes the process a little easier and cleaner. Very easy to use, I like the sleek black design with a loop to hang it from hooks to avoid mess! I've been testing this out for a couple weeks now and it's held up considerably well; the material hasn't lost its shape or taken any ugly creases. Washing is a breeze in the sink - I haven't tried in the washing machine yet, but I feel like it'd hold up. The mitt is not too thick, not too thin, product goes on smooth and even given that the material does the same with your self tanner that, say, a beauty blender would do with your foundation - it soaks up a little bit of product to make sure the overall application goes a long way, and keeps the whole surface looking smooth and even.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2020
J
Verified Purchase
Jason Stewart
West Palm Beach, US
★★★★★ 3
Absorbs your lotion
Pattern Name: 1 Tanning Mitt
Protects your hand and the application is smooth... BUT it absorbs SO MUCH PRODUCT!!! Like waists so much of your tanning lotion. I decided to stop using it and just wash my hands right after applying bc it isn’t worth how much lotion gets absorbed into the mitt & goes to waist.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2021

recommand products