SKU: 976766220

RSPO3 Protein, Human

Sale price$154.80 Regular price$172.00
Save 10%

Pay in installments of $43.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 16 - Jul 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

RSPO3 Protein, HumanProduct Specification Species Human Synonyms R spondin 3 Accession Q9BXY4 1 Amino Acid Sequence Gln22 Val146, with C terminal 8*His QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVGGGSHHHHHHHH Expression System HEK293 Molecular Weight 16 and 20 24kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms R-spondin 3
Accession Q9BXY4-1
Amino Acid Sequence

Gln22-Val146, with C-terminal 8*His QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

16 and 20-24kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

R-spondin3 (RSPO3), an activator of Wnt/β-catenin signaling, plays a key role in tumorigenesis of various cancers. RSPO3 contains two adjacent cysteine-rich furin-like domains (aa 35-135) with one potential N-glycosylation site (aa 36), followed by a thrombospondin (TSP-1) motif (aa 147-207) and a region rich in basic residues (aa 211-269). RSPO3 is a novel contraction-inducible myokine produced by cultured human myotubes. Human RSPO3 is a paracrine factor that may positively participate in the myogenesis processes of myoblasts and satellite cells. RSPO3 promotes the tumor growth of choriocarcinoma via Akt/PI3K/ERK signaling, which supports RSPO3 as an oncogenic driver promoting the progression of choriocarcinoma. RSPO3 plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this protein with bone mineral density and risk of fracture. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 976766220

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lucy Pevensie
Natrona Heights, US
★★★★★ 5
Very nice quality
Size: 2' x 3' (Sheepskin shape), Color: Creamy White, Size: 2' x 3' (Sheepskin shape), Color: Creamy White
I ordered three of these, and they arrived promptly and very well packaged in a vacuum seal pack. Once you pull them out, shake them and fluff them a little bit they lose their wrinkles pretty quickly. They seem to be very good quality and are authentically sheepskin. The “white” has a tiny little bit of a yellow undertone, which is what I expected since it’s basically a dyed sheep skin. I would call the white color “natural” rather than white white. They are very thick and were a good price. I ordered two of the three foot-long hides and one 6ft foot hide. One of the hides had a slight odor to it that reminded me a little bit of eggs. It’s been laying on my bench all night and 24 hours later there is no smell. The other two hides had zero smell at all. I think it’s just a little leftover chemical smell from the treatment of the hide when they get it ready. It wasn’t overwhelming or overpowering. If you’re looking for the ultimate SUPER plush sheepskin, I recommend the Overland Sheepskin Company. However, for what I need these for which is just something to throw over my dining room table bench for a little cushion and aesthetics. It’s absolutely perfect and the right price point.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2025
M
Verified Purchase
Mimi
Lexington, US
★★★★★ 5
Beautiful Good Quality Sheepskin, Beautifully Packaged
Size: 2' x 6' (Sheepskin shape), Color: Creamy White, Size: 2' x 6' (Sheepskin shape), Color: Creamy White
Very nicely packaged and presented sheepskin rug. Seems like very good quality and is just as I imagined it would be based on my previous experiences with sheepskin. I don’t think it’s as soft as others seemed to think but it has been chemically processed and it is very similar in texture to what I remember from past experiences with sheepskin. I got this for the kitties to nap on - one seemed proud of me for bringing home a pelt and went into hunt mode. The other looked at me suspiciously like he didn’t really know me at all and was afraid I could be eyeing him for his fur! Hopefully once they both adjust they’ll enjoy napping on it 🙀😻
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
S
Verified Purchase
sunshine
Lake Worth, US
★★★★★ 5
Full of beauty!
Size: 2' x 6' (Sheepskin shape), Color: Creamy White
This company takes pride in their work. The sheep skin covering is beyond what anyone could imagine. I purchased this for medicinal purposes. I found out I have SI joint dysfunction. And this sheepskin helps to relieve pressure points so I am using this as a chair covering for when I sit. The product came in a big box and then a plastic bag and then a third, well covered, plastic bag to protect the sheepskin. You will not be disappointed if you purchase this covering. The price was excellent. It will take your breath away. Very happy with my purchase. There was no odor when I opened the package. Many thanks for an excellent product and helping me to be more comfortable when I sit for short periods of time. :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
S
Verified Purchase
Sonja
West Palm Beach, US
★★★★★ 4
Nice, but almost feels faux to me
Size: 2' x 6' (Sheepskin shape), Color: Pink, Size: 2' x 6' (Sheepskin shape), Color: Pink
I like it, but it says it’s real, and I believe them, but it feels like it is faux. I’ve owned a fake one before and it feels similar. Please know I am not saying it is not real. I guess the fake was well done! It’s super long and I am still on the fence if I want it this long. I’ve taken a pic here, but right now it is wrapped in the package in case I need to return. It is soft and pretty, but I’m not sure that Barbie pink is my best choice lol. Usually I would pair it with a mid century modern bedspread that is chenille, with a little pink so it works well but not too matchy matchy. I wish I had taken a pic with that bedspread because the bit of pink on the bedspread looks very nice against the rug. So let me apologize for having it with an ugly bedspread.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 21, 2025
J
Verified Purchase
J. L. Abbott
Massapequa, US
★★★★★ 5
This is a wonderful sheepskin
Size: 2' x 3' (Sheepskin shape), Color: Creamy White
This sheepskin is so soft and comfortable. I use it on my couch and it really helped me stay warm in the winter months. Super glad I bought it. My cat loves it too
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026

recommand products