SKU: 97727716963

Mouse CD86, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD86, his tagProduct Specification Species Mouse Synonyms Activation B7 2 antigen,Early T cell costimulatory molecule 1 (ETC 1) Accession P42082 Amino Acid Sequence Protein sequence (P42082, Val24 Lys244, with C 10*His) VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKGGGGSHHHHHHHHHH Expression

Product Specification


Species Mouse
Synonyms Activation B7-2 antigen,Early T-cell costimulatory molecule 1 (ETC-1)
Accession P42082
Amino Acid Sequence

Protein sequence (P42082, Val24-Lys244, with C-10*His) VSVETQAYFNGTAYLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLGTEKLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSEPEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQDNVTELFSISNSLSLSFPDGVWHMTVVCVLETESMKISSKPLNFTQEFPSPQTYWKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 26.8 kDa Observed MW: 30-70 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Cluster of Differentiation 86 (also known as CD86 and B7-2) is a protein constitutively expressed on dendritic cells, Langerhans cells, macrophages, B-cells (including memory B-cells), and on other antigen-presenting cells. Along with CD80, CD86 provides costimulatory signals necessary for T cell activation and survival. Depending on the ligand bound, CD86 can signal for self-regulation and cell-cell association, or for attenuation of regulation and cell-cell disassociation. The CD86 gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. Alternative splicing results in two transcript variants encoding different isoforms. Additional transcript variants have been described, but their full-length sequences have not been determined.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97727716963

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
pushNpages
Waukegan, US
★★★★★ 5
thorn of mine
Format: Paperback
| fantasy romance | high fantasy | witch x necromancer | rune magic | death-made | fire mage | court politics | morally grey | political intrigue | mystery | secrets | enemies x lovers | quest | single POV | SLOW burn | feminine rage | SPICY | touch her and dxe | OCD rep | nicknames | anxiety rep | forbidden romance | cliff-hanger | plot-twist | one horse | care taking | It’s been a few years since I last read a story by Lisette Marshall, and I was instantly reminded why I love her work. Lisette is a master of weaving together rich fantasy worlds, complex characters, and heart-stopping romance. Lisette builds amazing worlds, develops intriguing characters, and crafts plots full of twists and turns. The final 30% had me wide awake in the middle of the night, anxious, thrilled, but also kicking my feet and grinning like a fool. Lisette truly knows how to build tension and then deliver an ending that causes a complete and utter crash out. The dynamic between Thraga, a rune witch on the run, and Duralin, a necromancing fire mage with secrets of his own, was absolutely electric. Their banter? Unforgettable. The dialogue was brimming with wit, tension, and just the right amount of venom. Underneath all that verbal sparring, though, was a surprising tenderness. A quiet, aching vulnerability that made their connection feel raw and real, while being layered underneath a resistance full of tension and hidden yearning. I especially admired the OCD and anxiety representation woven naturally into the story; it added authenticity and depth without ever feeling forced. The nature of OCD is repetitive, and the reality of anxiety is that it is always lurking beneath the surface. I found the representation to be so realistic and relatable. The world-building was lush, the mystery was gripping, and the slow burn? One of the slowest and most satisfying I’ve ever had the pleasure of reading and experiencing. The story unfolds entirely through Thraga’s POV, but Lisette gifts us a glimpse into Duralin’s mind at the end, truly, a perfectly placed moment that leaves you thirsting for the next book. The Death-Made Prince is everything I want in a fantasy romance: morally grey characters, delicious tension, sharp and cutting banter, and a world that feels alive with magic, secrets, and mystery. It’s easily one of my favorite reads of 2025, and I cannot wait to see what comes next. This is absolutely one of my favorite reads of 2025. I highly recommend The Death-Made Prince by Lisette Marshall. Happy Reading, Friends xx
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2025
T
Verified Purchase
Tea & Tomes
Belleville, US
★★★★★ 4
Dark, Twisty, Unforgettable
Format: Kindle
Thank you Lisette Marshall for the free gift! I really enjoyed this one, though I did feel it ran a bit long. Some of the pacing dragged, especially near the end where the characters seemed to face one too many “captured by the enemy” moments before the story moved forward again. Still, despite those slower stretches, the slow-burn romance was absolutely perfect. The tension between Thraga and Durlain built so naturally that when their connection finally deepened, it felt completely earned. The worldbuilding was rich and immersive, filled with fascinating magic and political intrigue that felt both original and grounded. The rune-based magic system, in particular, was such a refreshing and creative element. And as always, Lisette Marshall’s characters were layered, flawed, and endlessly compelling. Even with a few pacing hiccups, this story pulled me in completely, and that ending left me reeling. Lisette Marshall continues to prove why she’s one of my favorite authors. I can’t wait to see where she takes this series next. It promises to be dark, twisty, and unforgettable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 22, 2025
C
Verified Purchase
Cassie AReaderofRuin
Lake Worth, US
★★★★★ 5
The banter was bantering, and the slow burn was 🔥🥵🌶️🙌🏻
Format: Paperback, Format: Paperback
Two enemies, one desperate bargain, and an attraction that could ultimately destroy them both? I don’t know about you guys, but this was the perfect recipe for an all-night, feet kicking the air read! This book has it all: 🖤 Necromancer X Runewitch ⚔️ Norse Mythology 🖤 Deadly Quest ⚔️ OCD Rep 🖤 Enemies-to-lovers ⚔️ Morally Gray MCs 🖤 Reluctant Allies ⚔️ Feminine Rage 🔥 A slow burn so good you’ll be begging for more! What I loved: 🖤 The unique world-building. I’ve read a lot of witchy reads before, and they usually follow the same pattern, however, involving descendants of dragons (Fireborn) and Necromancers really created a unique spin to the witchy market. The rune magic system was intriguing, and in action, I found myself completely enamored with it and Thraga. 🖤 The OCD representation. Let’s be honest, if you don’t have OCD, you don’t often think about it, but to those who do experience OCD, even in minor forms, seeing a FMC with OCD was refreshing and added layers to her character. Thraga has been through so much trauma, and it translates into her OCD, showing her need to have control over some aspect of her life and body, when in reality, her OCD has taken complete control of her. Throughout the story, Durlain helps her to realize just how much the OCD (and other “things”) have taken away from her ability to truly be free. It is one of the most endearing arcs I have read in a while. 🖤 The tension and banter. This wouldn’t be a highly ranked read for me without the perfect balance of tension and toe curling banter. This is a SLOW BURN, but it is so perfectly paced and balanced. When things finally combust (and boy, do they), it is so tremendously satisfying that you don’t even care how long it took to get to that point. It was earned in every way. I highly recommend this book to any romantasy and paranormal romance enthusiast. It hits all of the right marks, and the ending will have you staring at the wall. I am going to be incredibly surprised if this doesn’t get picked up by a traditional publisher at some point, it was that good! Final rating: 4.5 ⭐️ 1.75 🌶️ 🚨 Check TWs 🚨
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 21, 2025
D
Verified Purchase
Dylan Lemox
Alexandria, US
★★★★★ 5
Fantastic Read!
Format: Paperback
🖤”𝑰𝒇 𝒕𝒉𝒆 𝒘𝒐𝒓𝒍𝒅 𝒉𝒂𝒅 𝒕𝒐 𝒃𝒆 𝒕𝒆𝒓𝒓𝒊𝒃𝒍𝒆, 𝑰 𝒄𝒐𝒖𝒍𝒅 𝒃𝒆 𝒔𝒐, 𝒔𝒐 𝒎𝒖𝒄𝒉 𝒘𝒐𝒓𝒔𝒆.”💜 The Death-Made Prince by Lisette Marshall is the perfect enemies to lovers read!😍🐦‍⬛💜 🖋️Review Thraga lives in a world where runewitches are killed for simply existing. Just hours from being sent to the gallows, a mysterious prisoner shows up and sets her on a path she never thought possible. When these two collide, they are never the same. This book is Lisette’s best work yet! I loved the characters, the story, and the romance. The tension between these two characters was palpable and I ATE IT UP!!! Between the fast-paced plot and the witty banter, I couldn't put this one down. The OCD rep in this book was perfection. I loved how Lisette explored grief and overcoming heartache in this one. From the magic system to the Norse lore this book was such a fantastic read. I cannot wait to read book two and explore more of this story and this amazing world the author has created. And that freaking ending!!! 🤯😳🫢 Do not sleep on this book, it has everything you want in a romantasy and more!!! If you enjoy creative magic systems, yearning and tension that will have you melting and kicking your feet, epic action and adventure, or well thought out complex characters, look no further this book is for you!! Genre: Fantasy Romance Publication Date: October 21st, 2025 Series: Runewitch Saga - Book 1 Pages: 545 ⭐️-5 🌶️-2 Tropes: 🐦‍⬛Both MCs are Morally Grey 🗡️Enemies to Lovers 💜OCD Rep 🐦‍⬛Deadly Quest 🗡️Norse Mythology 💜Necromancer & Witch 🐦‍⬛Slow Burn with Spice And More… 🚨⚠️This book has dark elements and is not suitable for all readers. Please be sure to check the trigger warnings before reading this book!⚠️🚨
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 20, 2025
A
Verified Purchase
arienwen
Louisville, US
★★★★★ 4
An Unforgettable Fantasy Read
Format: Paperback
⭐️3.75/5 stars ⭐️ I can’t, in good faith, talk about this book without mentioning the end. If you are a reader who despises cliffhangers, you might want to add this to your TBR (and you’re going to want to read it) until the sequel is announced, because I am STILL reeling over that ending. This cliffhanger is the cliff that keeps on giving. It’s going to stay with me until the day I get to read Book 2. Why are you going to want to read The Death-Made Prince anyway? First and foremost is the world that Lisette Marshall has created with such a unique and refreshing magic system! I was hooked from the first mention of runes and necromancy. Linguistics is a subject that has always fascinated me, both in reality and in fantasy. Seeing Thraga’s runic witchcraft described as a formulaic language made both my mathematician and reader hearts throb with anticipation. Moreover, I loved Marshall’s take on necromancy - I didn’t realize how literal the “death-made” title for Durlain would be! In The Death-Made Prince, Marshall really does combine a variety of magical elements to create a fantasy world that is hard to leave. But what also makes The Death-Made Prince hard to ignore are the characters. Thraga and Durlain both have their tragic backstories, but it’s what lies beyond their backstories that truly make them stand out. Thraga is a runewitch with OCD and anxiety, and I just have to say that the representation is ON POINT. On the other hand, Durlain is a loveable black cat MMC who tries so hard to be an idiot (and does succeed). While their enemies-to-lovers relationship is a slow, slow, SLOW burn, it makes it all worth it in the “end.” The banter between them is top-notch and had me hooked and invested throughout. There were times when their banter was the only thing that kept me reading. The first 50% was slow and I had some trouble staying invested. BUT, I will encourage any reader who looks at my review to STICK WITH IT. The last 20-30% of the book made it oh so worth it. It really picks up once Durlain and Thraga arrive at the Dawn House (iykyk), featuring secrets, lies, and espionage. Oh, and of course the sexual tension. From then on, the plot moved quickly, and I couldn’t put my Kindle down. And then, there was the cliffhanger. But you already knew that. All in all, The Death-Made Prince introduced a fantasy world that I am loath to leave (even if for a little bit). While the beginning was slow and seemed to drag on, the end was amazing and I do not, and never will, regret reading it. Catch me again when Book 2 is announced… Thank you to Lisette Marshall and the team at Behind the Pages for letting me read an early copy of The Death-Made Prince! I’m honored to give my honest thoughts on this book and support its release.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2025

recommand products