Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 15 - Aug 20
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Rabbit IL21, His tagProduct Specification Species Rabbit Amino Acid Sequence Protein sequence (XP_008266192. 1, His18 Arg150, with C His tag) HKSSSKGQDRYMIRMHQLLDIVDQLQSDVNDLDPDFLPAPQDVQKGCEQSAFSCFQKAQLKPANAGDNGKRISSLIKQLKRKLPSTKSKKTQKHRPTCPSCYSYEKKNLKEFLERLKSLIQKMIHQHLLEHLR Expression System HEK293 Molecular Weight Predicted MW: 15. 4 kDa Observed MW: 18 kDa Purity 95% by SDS PAGE Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m filtered
Product Specification
| Species | Rabbit |
| Amino Acid Sequence | Protein sequence (XP_008266192.1, His18-Arg150, with C-His tag) HKSSSKGQDRYMIRMHQLLDIVDQLQSDVNDLDPDFLPAPQDVQKGCEQSAFSCFQKAQLKPANAGDNGKRISSLIKQLKRKLPSTKSKKTQKHRPTCPSCYSYEKKNLKEFLERLKSLIQKMIHQHLLEHLR |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 15.4 kDa Observed MW: 18 kDa |
| Purity | ＞95% by SDS-PAGE |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Interleukin 21 (IL-21) is a cytokine that has potent regulatory effects on cells of the immune system, including natural killer (NK) cells and cytotoxic T cells that can destroy virally infected or cancerous cells. IL-21 is noted to have anti-tumour effects through continued and increased CD8+ cell response to achieve enduring tumor immunity. IL-21 may contribute to the mechanism by which CD4+ T helper cells orchestrate the immune system response to viral infections. In HIV infected subjects, IL-21 has been reported to critically improve the HIV-specific cytotoxic T cell responses and NK cell functions. IL-21 was approved for Phase 1 clinical trials in metastatic melanoma (MM) and renal cell carcinoma (RCC) patients. IL-21 proceeded to Phase 2 clinical trials where it was administered alone or coupled with drugs as sorafinib and rituximab.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy