SKU: 98042027639

Human Fas/CD95, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Fas/CD95, His tagProduct Specification Species Human Synonyms Apo 1 antigen, Apoptosis mediating surface antigen, FAS, FASLG receptor, APT1, FAS1, TNFRSF6 Accession P25445 Amino Acid Sequence Protein sequence (P25445, Met1 Asn173, with C 10*His) MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNGGGGSHHHHHHHHHH Expression System HEK293 Molecular

Product Specification


Species Human
Synonyms Apo-1 antigen, Apoptosis-mediating surface antigen, FAS, FASLG receptor, APT1, FAS1, TNFRSF6
Accession P25445
Amino Acid Sequence

Protein sequence (P25445, Met1-Asn173, with C-10*His) MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 21 kDa Observed MW: 25-40 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The Fas receptor, also known as Fas, FasR, apoptosis antigen 1 (APO-1 or APT), cluster of differentiation 95 (CD95) or tumor necrosis factor receptor superfamily member 6 (TNFRSF6), is a protein that in humans is encoded by the FAS gene. Fas was first identified using a monoclonal antibody generated by immunizing mice with the FS-7 cell line. Thus, the name Fas is derived from FS-7-associated surface antigen. The Fas receptor is a death receptor on the surface of cells that leads to programmed cell death (apoptosis) if it binds its ligand, Fas ligand (FasL). It is one of two apoptosis pathways, the other being the mitochondrial pathway.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 98042027639

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
ESI
Pawtucket, US
★★★★★ 5
Great Looking Suit with Lightweight Material
Color: Light Grey, Size: 7
I got this for a beach wedding and it worked out really well. It looked nice without feeling too formal, which was perfect for the setting. The material is linen and it feels lightweight and breathable. It kept my kid comfortable in the heat and didn’t feel stiff or heavy like some dress suits do. The appearance is sharp. The double breasted style makes it look more dressed up, but the linen material keeps it relaxed and appropriate for outdoor events. The fit was true to size. It sat well without looking baggy or tight, and everything stayed in place throughout the event. Quality feels good for the price. The fabric and stitching don’t feel cheap, and it held up well after a full day of wear. Suitability is great for things like weddings, parties, or photos. It works especially well for warmer weather because of the material. For value, I think it’s worth it. You’re getting a nice looking suit with comfortable material that actually works in real situations. Overall, great fit, breathable material, and a clean look that works really well for events.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
A
Amber Smith
Lexington, US
★★★★★ 5
Very nice linen suit for boys. Well worth the piece
Color: Beige, Size: 12
This JPF Double Breasted Linen Suit for Boys is the cutest thing I've ever seen! I got itt for my 8 year old and he loves it! He tried it on at soon as we received it and wore it all evening. Lol. He looks so grown up! He's about 4'3", about 75lbs. I ordered a size 12 and it fits him the way I'd expect it to. A bit big but he has room to grow into it. It is a 2 piece suit, with pants and blazer only. It's a summer suit, it's meant to have a more laid back, casual style. It is so nice! The style and color are identical to the photo. I got the beige color, that's the color my kid picked. I do worry a bit about staining, considering an 8 year old boy will be wearing it, but hopefully any stains will be easy to remove. The quality is excellent and the price isn't bad either. I highly recommend this suit
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
J
Jessica S
Los Angeles, US
★★★★★ 5
A charming summer suit
Color: Light Grey, Size: 6, Color: Light Grey, Size: 6
This suit fit true to size. The light grey wasn’t exactly the same as advertised (see photo), but I still really like it. My son felt snazzy in this suit, and he said it was comfortable to wear.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
B
Brandon_In_Indy
Lexington, US
★★★★★ 5
Nice suit for the price!
Color: Light Grey, Size: 12, Color: Light Grey, Size: 12
This really is a very nice boys suit, especially for the price they are asking. My kids don't wear suits too often, maybe once or twice a year for special occasions so I don't need really expensive suits for them. The material is actually really nice on this. The color looks great and the pieces are sewn nicely. The adjustable waist band is really nice on the pants because my kids are on the slimmer side and this helps with fitting. You can also wear a belt with these if needed. I washed on delicate cycle and dried on delicate cycle a little, then finished by air drying. They washed and dried very nicely with minimal wrinkling. The front pockets are real and useable on these, which isn't always the case with boys suits. Overall would 100% recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
U
Upstate G-MA
Bozeman, US
★★★★★ 4
Nice looking suit that runs big
Color: Light Grey, Size: 6, Color: Light Grey, Size: 6
This is a beautiful light, gray linen suit size 6. It looks high end and it is a baggy fit, not slim. This suit is double breasted with a satin lining inside. There are two pockets in the jacket and one small smaller pocket for a handkerchief on the jacket. I did order a size 6 but this fits way too big for a size 6 I’m thinking it was more like a seven or an eight. The pants have a zipper, which moves very easily and 2 pockets. The Pants have belt loops. Both the the pants and jacket are longer than normal. My son is tall, so I was really surprised that these are so baggy and so long. I would definitely double check the size. there’s no size chart online so maybe I would go one size down. It does look like a quality made suit. The sizing is just off.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2026

recommand products