SKU: 81495002018

MERTK His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 10 - Jul 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MERTK His Tag Protein, MouseProduct Specification Species Mouse Synonyms MER, STK Kinase, Tyro12, C Eyk, C Mer, RP38 Accession Q60805 Amino Acid Sequence Gly19 Met497, with C terminal 8*His

Product Specification


Species Mouse
Synonyms MER, STK Kinase, Tyro12, C-Eyk, C-Mer, RP38
Accession Q60805
Amino Acid Sequence

Gly19-Met497, with C-terminal 8*His GGTAEKWEETELDQLFSGPLPGRLPVNHRPFSAPHSSRDQLPPPQTGRSHPAHTAAPQVTSTASKLLPPVAFNHTIGHIVLSEHKNVKFNCSINIPNTYQETAGISWWKDGKELLGAHHSITQFYPDEEGVSIIALFSIASVQRSDNGSYFCKMKVNNREIVSDPIYVEVQGLPYFIKQPESVNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEKPERSPSVLTVPGLTETAVFSCEAHNDKGLTVSKGVHINIKVIPSPPTEVHILNSTAHSILVSWVPGFDGYSPLQNCSIQVKEADRLSNGSVMVFNTSASPHLYEIQQLQALANYSIAVSCRNEIGWSAVSPWILASTTEGAPSVAPLNITVFLNESNNILDIRWTKPPIKRQDGELVGYRISHVWESAGTYKELSEEVSQNGSWAQIPVQIHNATCTVRIAAITKGGIGPFSEPVNIIIPEHSKVDYAPSSTPAPGNTDSMGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 80-110kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Graham, D.K. et al. (1994) Cell Growth Differ. 5:647.

2.Graham, D.K. et al. (2006) Clin. Cancer Res. 12:2662.

Background

Tyrosine-protein Kinase Mer, also known as c-Mer and MerTK, is a member of the receptor tyrosine kinase subfamily TAM (Tyro3, Axl, and Mer). Similar to Axl and Tyro3, the extracelluar domain of Mer contains two Ig-like motifs and two fibronectin type III motifs. Mer is not expressed in normal B- and T-cells but expressed in neoplastic B- and T-cell lines . It is also show higher expression in immunosuppressive M2‑like macrophages. Following activation by ligand, interacts with GRB2 or PLCG2 and induces phosphorylation of MAPK1, MAPK2, FAK/PTK2 or RAC1. MERTK signaling plays a role in various processes such as macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization and engulfment. Functions in the retinal pigment epithelium (RPE) as a regulator of rod outer segments fragments phagocytosis. Plays also an important role in inhibition of Toll-like receptors (TLRs)-mediated innate immune response by activating STAT1, which selectively induces production of suppressors of cytokine signaling SOCS1 and SOCS3.Mer is known to bind Gas6, Protein S, Tubby, Tubby-like protein 1 (Tulp1), and Galectin-3. Upon binding ligands via the Ig-like motif, Mer is dimerized to trans-autophosphorylate the kinase domain to induce downstream signaling. It has been shown that Mer signaling in macrophages induces M2 polarization, which promote tumor growth, metastasis and evasion of anti-tumor immunity in tumor microenviroment. Inhibition of Mer, especially on leukocytes and macrophages, is an effective anti-cancer therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 81495002018

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 2121 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michael
Los Angeles, US
★★★★★ 5
Comfortable dress shoe.
Size: 7, Color: Brown Napa Leather
Finally a comfortable dress shoe. It's both comfortable to walk in and looks and wears like a more traditional dress shoes for the office.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
C
Verified Purchase
Christopher
Cuba, US
★★★★★ 5
Slip-on ready and great quality
Size: 9, Color: Black
These shoes were stuff for the first half hour but then feel great. Well worth the chance and money. Great quality and slip-on easy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
D
Verified Purchase
Derek Preston
Fort Morgan, US
★★★★★ 5
Great buy
Size: 11, Color: Tan
Great fit comfortable look good
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
M
Verified Purchase
mike t.
Waukegan, US
★★★★★ 5
Great shoes
Size: 14 Wide, Color: Black
My shoes look good and feel good and now I’m going to purchase the brown pair I saw
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
N
Verified Purchase
Nicholas D. Clark
Alexandria, US
★★★★★ 4
Don’t buy for restaurant industry
Size: 10.5, Color: Black, Size: 10.5, Color: Black
Good looking shoes, fairly comfortable and good value based on the description shared, so I don’t feel it’s fair to rate them lower than 4 stars. I had high hopes for them based on previous reviews from others saying they wore them in the food and beverage industry that mentioned their quality and durability, however I strongly recommend looking elsewhere if you do. I purchased these to wear working in a full service upscale restaurant and in less than two months have managed to have torn the material on the middle exterior section and the bottoms of the shoes are already completely worn down. Good design, but the durability needs to be improved if they’re to hold up for that industry.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 18, 2025

recommand products