Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 17 - Jul 22
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human IL-19, His tagProduct Specification Species Human Synonyms Melanoma differentiation associated protein like protein, NG. 1, ZMDA1 Accession Q9UHD0 Amino Acid Sequence Protein sequence(Q9UHD0, Leu25 Ala177, with C 10*His) LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSAGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 19. 5kDa Actual: 29kDa
Product Specification
| Species | Human |
| Synonyms | Melanoma differentiation-associated protein-like protein, NG.1, ZMDA1 |
| Accession | Q9UHD0 |
| Amino Acid Sequence | Protein sequence(Q9UHD0, Leu25-Ala177, with C-10*His) |
| Expression System | HEK293 |
| Molecular Weight | Theoretical: 19.5kDa Actual: 29kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Interleukin 19 (IL-19) is an immunosuppressive protein that belongs to the IL-10 cytokine subfamily. The IL-19 protein is composed of 159 amino acids and has a quaternary structure with alpha helix motifs and loops. IL-19 is preferentially expressed in monocytes, macrophages, and T and B lymphocytes, but interacts with immune cells (macrophages, T cells, B cells) and non-immune cells (endothelial cells and brain resident glial cells, etc). IL-19 is associated with broad functions across inflammation, cell development, viral responses, and lipid metabolism. As an immunosuppressive cytokine, IL-19 promotes the Th2 (regulatory) T-cell response which supports an anti-inflammatory lymphocyte phenotype, dampens the Th1 T-cell response and inflammatory cytokine secretion (IFNγ), increases IL-10 (anti-inflammatory) expression in peripheral blood mononuclear cells (PBMC), and inhibits the production of immunoglobulin G (IgG) from B cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy