SKU: 50671232315

Biotinylated CD40 Fc&Avi Tag Protein, Human

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated CD40 Fc&Avi Tag Protein, HumanProduct Specification Species Human Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5 Accession P25942 Amino Acid Sequence Glu21 Arg193, with C terminal Human IgG1 Fc & Avi Tag

Product Specification


Species Human
Synonyms CD40, Bp50, CDW40, MGC9013, TNFRSF5
Accession P25942
Amino Acid Sequence

Glu21-Arg193, with C-terminal Human IgG1 Fc & Avi Tag EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

55-60kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Human Fc Tag, Avi Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Chatzigeorgiou A, et al. (2009) CD40/CD40L signaling and its implication in health and disease. Biofactors. 35(6): 474-83.

2、Li R. et al. (2009) Expression of CD40 and CD40L in Gastric Cancer Tissue and Its Clinical Significance. Int J Mol Sci. 10(9): 3900-17.

3、Lievens D. et al. (2009) The multi-functionality of CD40L and its receptor CD40 in atherosclerosis. Thromb Haemost. 102(2): 206-14.

Background

CD40 is also known as TNFRSF5, Bp50, CDW40, MGC9013, TNFRSF5 and p50, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins, and plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation. The binding of CD154 (CD40L) on TH cells to CD40 activates antigen presenting cells and induces a variety of downstream effects. CD40 contains 4 cysteine-rich repeats in the extracellular domain, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines. Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Both CD40 and CD40 L have a membrane form and a soluble form generated by proteolytic cleavage or alternative splicing. CD40 and CD40L are widely expressed in various types of cells, among which B cells and myeloid cells constitutively express high levels of CD40, and T cells and platelets express high levels of CD40L upon activation. CD40L self-assembles into functional trimers which induces CD40 trimerization and downstream signaling. CD40/CD40L immune checkpoint leads to activation of both innate and adaptive immune cells via two-way signaling. CD40/CD40L interaction also participates in regulating thrombosis, tissue inflammation, hematopoiesis and tumor cell fate. The mechanisms of benefits include immune cell activation and tumor cell lysis/apoptosis in malignancies, or immune cell inactivation in autoimmune diseases and allograft rejection.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50671232315

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Dan Che
Belleville, US
★★★★★ 5
Perfect Blend of Comfort and Style
Size: 9, Color: Brown, Size: 9, Color: Brown
I recently purchased size 9 of these shoes, and they exceeded my expectations in every way! Here’s what I love about them: 1. Comfort: The moment I put them on, I noticed how soft and supportive they felt. The cushioning provides all-day comfort, making them perfect for long walks, workdays, or running errands. 2. Fit: The sizing is spot-on! I ordered my usual size, and they fit perfectly with no need to size up or down. There’s enough room for my toes to move without feeling too loose or tight. 3. Style: These shoes look even better in person. The design is sleek and versatile, making them easy to pair with both casual and semi-formal outfits. I’ve received several compliments already! 4. Durability: I put it on the day of purchase. After wearing them daily for a couple of days, they still look brand new. The stitching and material seem high-quality and built to last. 5. Value for Money: For the price, these shoes deliver exceptional value. You’re getting premium comfort and style without breaking the bank. Final Thoughts: If you’re looking for shoes that offer comfort, style, and durability, I highly recommend giving these a try. I’ll definitely be considering another pair in a different color soon! To conclude, I’m very happy for this purchase. Will definitely buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 13, 2025
R
Verified Purchase
Roderick
New York, US
★★★★★ 5
Great Purchase
Size: 12, Color: Black
These shoes are great. They look great and extremely comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
I
Verified Purchase
Isaiah O
San Leandro, US
★★★★★ 5
Comfortable, Easy to Clean, and Held Up at Coachella
Size: 12, Color: White, Size: 12, Color: White
I’m really happy with this purchase. The shoes are very comfortable, and the product description is accurate. I followed the sizing recommendation based on my foot type and went one size up—they fit perfectly. I bought these for Coachella, and they definitely held up. I was on my feet all day, and they stayed comfortable the entire time. What impressed me most is how easy they were to keep clean. At the end of each day, I was able to wipe them down and maintain their whiteness without much effort. Once I got home, I gave them a deeper clean, and they honestly looked as good as new. Even the laces cleaned up easily. Now I’ve transitioned them into my regular work shoes, and they still look great. Overall, I’m very satisfied with this purchase and would definitely recommend them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
H
Verified Purchase
Hawaiian
Birmingham, US
★★★★★ 4
Great shoes that are well made, lite weight, and comfortable.
Size: 12, Color: Brown
Just received my 2nd pair of shoes from Bruno Marc in a size 12. These are really lite and comfortable. It can be dressed down to be a casual shoe or dressed up with a nice suit. These run true to size so I ordered my usual size 12 and the fit was perfect. Being my 2nd pair of Bruno Marc's, I like the quality of their shoes and each shoe is described appropriately on fit and comfort. Insole of these shoes were awesome and provided soft comfort on the feet along with a slight arch support too. Will definitely consider ordering more Bruno Marc shoes in the future.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2025
J
Verified Purchase
JCMIV63
Cuba, US
★★★★★ 5
Cushioned, comfortable, stylish and a rubber sole!
Size: 10, Color: Brown
These shoes check multiple boxes for me, comfortable, cushioned, rubber sole and stylish. As my feet grow old and worn out, I'm on a constant search for comfortable, cushioned shoes that are suitable for work and dressier occasions. I have tried many expensive shoes that look great but either lack cushioning, arch support and or comfort. One of the nice things is these shoes have a rubber sole, where most cushioned shoes have the foam soles which are great, but they tend to lack grip particularly when its damp/wet. They have average arch support, but the insole is removable and I put my own cushioned arch support. Love these!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026

recommand products