SKU: 78000618301

TGFBR2 Fc Chimera Protein, Human

Sale price$250.56 Regular price$278.40
Save 10%

Pay in installments of $69.60 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TGFBR2 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2 Accession P37173 Amino Acid Sequence Thr23 Asp159, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2
Accession P37173
Amino Acid Sequence

Thr23-Asp159, with C-terminal Human IgG1 Fc TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

55-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1.Biros E, et al. (2011) Meta-analysis of the association between single nucleotide polymorphisms in TGF-β receptor genes and abdominal aortic aneurysm.  Atherosclerosis. 219(1):218-23.

Background

TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein. TGFBR2 is comprised of a C-terminal protein kinase domain and an N-terminal ectodomain. The ectodomain consists of a compact fold containing nine beta-strands and a single helix stabilized by a network of six intra strand disulfide bonds. The folding topology includes a central five-stranded antiparallel beta-sheet, eight-residues long at its centre, covered by a second layer consisting of two segments of two-stranded antiparallel beta-sheets. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and thus regulates a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.Mutations in TGFBR2 gene have been associated with Marfan syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78000618301

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tracy L Cook
Chelsea, US
★★★★★ 5
Fantastic Insurance
If you doubt getting this insurance, DON’T!!! Ausurion delivers 5star coverage and their customer service support is wonderful. Absolutely would recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
C
Verified Purchase
cbtn
Lowell, US
★★★★★ 5
Full Refund on Vacuum
I purchased the 3 year plan for my robotic vacuum. It stopped working at about the 1 year point. Went to their site, printed the prepaid label, dropped it off at UPS store near me. The sent an email letting me know they received the vacuum, then another email that they were trying to repair it, then another email about two weeks after I mailed it letting me know that a gift card for the full amount would be issued via email to mail as they could not repair it. Took the gift card credit on amazon and purchased a different vacuum. I bought the insurance again, it is worth it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2024
L
Verified Purchase
Lisa Pippin
Waukegan, US
★★★★★ 5
No problem at all
I purchased a warranty on my vaccum cleaner and it was not picking up when I ran it like it always had. The head part was squeaking and hard to run. I filed a claim they sent me a label we boxed it up and sent it in. They sent emails letting me know when they got it and it was being worked on, Then we it was done they emailed me also, It runs like a new one I am very pleased and so glad I purchased the warranty. Well worth the price for the value!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 17, 2024
C
Verified Purchase
Cailey M.
Lowell, US
★★★★★ 4
IRobot Roomba 3 year warranty
My roomba stopped working as it should. It took two claims to get things taken care of but at the end, I was given a gift card for the original purchase price, which I used to buy a brand new roomba. 😁 so im satisfied and purchased another warranty for the new one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2026
A
Verified Purchase
Amazon Customer
Natrona Heights, US
★★★★★ 5
Great insurance!
It worked wonders for me! I sent back my vacuum after a year of using it because a broken spinning wheel and they repaired it. Then, three weeks before the insurance cover expired, a lightning storm occurred in my area and my vacuum didn’t work anymore, they said they couldn’t fix it and they sent me a full refund. Of course I’ll recommend Asurion insurance!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 18, 2025

recommand products