SKU: 10169803193

Human VEGF 121, His Tag

Sale price$105.75 Regular price$117.50
Save 10%

Pay in installments of $29.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VEGF 121, His TagProduct Specification Species Human Synonyms Vascular endothelial growth factor A, VEGF A, VPF Accession P15692 9 Amino Acid Sequence Protein sequence(P15692 9, Ala27 Arg147, with C 10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 15. 7kDa Actual: 16,20kDa Purity 95% by SDS PAGE Conjugation Unconjugated

Product Specification


Species Human
Synonyms Vascular endothelial growth factor A, VEGF-A, VPF
Accession P15692-9
Amino Acid Sequence

Protein sequence(P15692-9, Ala27-Arg147, with C-10*His)


APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 15.7kDa Actual: 16,20kDa

Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Vascular endothelial growth factor (VEGF) is a signal protein produced by many cells that stimulates the formation of blood vessels. To be specific, VEGF is a sub-family of growth factors, the platelet-derived growth factor family of cystine-knot growth factors. They are important signaling proteins involved in both vasculogenesis (the de novo formation of the embryonic circulatory system) and angiogenesis (the growth of blood vessels from pre-existing vasculature). VEGF121 is the only form that lacks a basic heparinbinding region and is freely diffusible.  It plays an important role in neurogenesis both in vitro and in vivo (Storkebaum et al.). It has neurotrophic effects on neurons of the central nervous system and promotes growth and survival of dopaminergic neurons and astrocytes. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 10169803193

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
milt loper
West Palm Beach, US
★★★★★ 4
the "fit" is very precise
Style: BE-176H 1-Pack
Nice Fabrication, Good materials, perfect adhesive applications, "clean joints" etc. Appears to be a good UPGRADE from the stock Motorcraft product. CONs: The FIT was a "smidge TIGHT", and took very precise initial alignment and "pressure" to begin to slide into the rectangular hole. I measured the "Hole" at 7.375" wide, or (187.33 mm)... the FILTER is exactly the SAME. I would suggest maybe reducing the Width by 1 mm, to allow for an easier installation. The MOTORCRAFT uses an "open-cell" foam structure for the (2) Side pieces on their filter assembly, allowing some "compression to fit", of the Width, easing the difficulty of installation, yet still filling all voids. In summation, the "fit" is very precise. Not to be hurried or rushed, maybe a bit meticulous for the impatient or weak of heart.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2025
A
Verified Purchase
Albert Sacluti
Port Orchard, US
★★★★★ 5
Great item and Affordable
Style: BE-157H 1-Pack
Perfectly fit for my corolla
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
R
Verified Purchase
Rafael B. Tejada
Cuba, US
★★★★★ 5
Breathe Easy!
Style: BE-728H 1-Pack
Ladies and gentlemen, buckle up, because we're about to embark on a whirlwind adventure of cleaner air and contortionist-worthy installation feats with the Spearhead HEPA Breathe Easy Cabin Filter! First off, let's talk about installation. If you're someone who loves a good yoga session or considers themselves a Cirque du Soleil dropout, this is the filter for you. The instructions are so clear and helpful that even a goldfish could follow them. However, be prepared to twist and turn in ways you didn't know your body could. And let me tell you, I'm not in the best of shape. I discovered muscles I never knew I had and positions that would make a pretzel jealous. But don't worry, it's all worth it. Once installed, my car’s air quality shot up faster than a rocket to Mars. And although my car is old and doesn't have any fancy AI, it felt like it was saying, "Ahh, finally, some quality air!" The air was so crisp and pure, I half expected to see little cartoon birds chirping around my head. And let me emphasize this: the product quality is top-notch. It not only works great but looks good too. I purchased this gem because my wife has bad allergies, and so far, it's been a game-changer. She hasn't sneezed once, and the car doesn't smell as musty with the air conditioning on. It's like we've been transported to a fresh, alpine air paradise every time we drive. In summary, the Spearhead HEPA Breathe Easy Cabin Filter is a game-changer. It's as easy to install as putting on socks—if putting on socks required you to become a human origami. But trust me, once it's in place, your lungs will thank you, and your car will feel like it's breathing the fresh, alpine air of the Swiss Alps. Five stars, and a standing ovation from my now incredibly limber body!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 10, 2024
L
Verified Purchase
LaDonna Knight
Chelsea, US
★★★★★ 5
Works a lot better than the previous one.
Style: BE-775H 1-Pack
Great product at a great price. It seemed to fit almost perfect with out having to crunch it in. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2026
J
Verified Purchase
Jinya Ramen Bar
Chelsea, US
★★★★★ 5
Great Cabin Filter Upgrade
Style: BE-729H 1-Pack, Style: BE-729H 1-Pack
I recently replaced my old cabin air filter with this one, and the difference was noticeable right away. Installation was quick and straightforward took less than 10 minutes with no special tools needed. What I appreciate most is the air quality improvement. The airflow feels stronger, and there’s a clear reduction in dust, odors, and outside pollution entering the cabin. If you’re looking for an easy, affordable upgrade that actually makes a difference in everyday driving comfort, this cabin filter is definitely worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 19, 2025

recommand products