SKU: 86411168073

Human VEGF 121, His Tag

Sale price$105.75 Regular price$117.50
Save 10%

Pay in installments of $29.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VEGF 121, His TagProduct Specification Species Human Synonyms Vascular endothelial growth factor A, VEGF A, VPF Accession P15692 9 Amino Acid Sequence Protein sequence(P15692 9, Ala27 Arg147, with C 10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 15. 7kDa Actual: 16,20kDa Purity 95% by SDS PAGE Conjugation Unconjugated

Product Specification


Species Human
Synonyms Vascular endothelial growth factor A, VEGF-A, VPF
Accession P15692-9
Amino Acid Sequence

Protein sequence(P15692-9, Ala27-Arg147, with C-10*His)


APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 15.7kDa Actual: 16,20kDa

Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Vascular endothelial growth factor (VEGF) is a signal protein produced by many cells that stimulates the formation of blood vessels. To be specific, VEGF is a sub-family of growth factors, the platelet-derived growth factor family of cystine-knot growth factors. They are important signaling proteins involved in both vasculogenesis (the de novo formation of the embryonic circulatory system) and angiogenesis (the growth of blood vessels from pre-existing vasculature). VEGF121 is the only form that lacks a basic heparinbinding region and is freely diffusible.  It plays an important role in neurogenesis both in vitro and in vivo (Storkebaum et al.). It has neurotrophic effects on neurons of the central nervous system and promotes growth and survival of dopaminergic neurons and astrocytes. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 86411168073

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jorge Selman
San Leandro, US
★★★★★ 5
If you want a great soap in a budget, buy Cremo body wash.
Scent: Cypress Santal, Size: 16 Fl Oz (Pack of 1)
Really good soap!! Leaves your skin soft and smells great. Light fragance and provides a good lather.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
D
Verified Purchase
David Percival Flores
Natrona Heights, US
★★★★★ 5
Beat the Humidity with This Citrus Powerhouse
Scent: Bergamot, Size: 16 Fl Oz (Pack of 1)
​In the middle of a brutal, humid Philippine summer, finding a body wash that actually boosts your confidence is a game-changer. Cremo’s Italian Bergamot isn’t just a soap; it’s a full olfactory experience. It opens with a vibrant, tart Italian bergamot that immediately cuts through the heat, followed by the freshness of vetiver, and the neroli blossom adds a sophisticated floral touch. ​True to Cremo’s Reserve collection, the scent is beautifully layered. It builds in intensity as you lather, allowing the earthy, fresh vetiver to anchor the citrus. Unlike many drugstore options, this lingers—stepping out of the shower, you can still catch the crisp citrus and the clean, woody dry-down on your skin. It’s the ultimate reset for a hot day.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
M
Verified Purchase
madeline bohn
Fort Morgan, US
★★★★★ 5
Awesome
Scent: Blue Cedar & Cypress, Size: 16 Fl Oz (Pack of 1)
This soap smells fantastic, and leaves you feeling clean! Great find, went back to buy the other scents!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
S
Verified Purchase
Stan Ohis
Belleville, US
★★★★★ 4
I Smell Like a Gentleman Who Owns a Fireplace
Scent: Bourbon Oak, Size: 16 Fl Oz (Pack of 1)
The fragrance is warm, woody, and slightly sweet...that low amber note that smells expensive without trying to smell expensive, which, as we all know, is the actual expensive smell. My wife walked past me twenty minutes post-shower and said, unprompted, "You smell really good." I nodded like I had planned this. The lather is genuinely rich; squeeze a modest amount and it blooms into a thick, creamy foam that covers everything efficiently. The texture is silky rather than watery, which matters more than people admit. Watery body washes feel like rinsing off with slightly scented regret. This one feels intentional. It cleans, and your skin actually feels clean afterward, not just rinsed. And the moisturizing? I wasn't expecting it. No greasy film, no lotion-begging dry patches by midday. Just quietly softer skin that doesn't make a big announcement about it. Now, my honest gripe: the scent longevity has a ceiling. By mid-afternoon you're back to neutral. That's the gap between four stars and five for me. For daily freshness and an incredible morning window of smelling genuinely great, it absolutely delivers...but it won't carry you to bedtime. On value: 16 fl oz is decent, the lather is efficient so the bottle lasts, and the price sits in that sweet spot where you feel like someone who makes slightly elevated but still reasonable choices, which is exactly the vibe this entire product is going for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
K
Verified Purchase
Kindle Customer
Natrona Heights, US
★★★★★ 5
Lathers great in a small amount!
Scent: Bergamot, Size: 16 Fl Oz (Pack of 1), Scent: Bergamot, Size: 16 Fl Oz (Pack of 1)
Lathers great for a small amount! A fair price for the amount and rich content. I just bought, used and love it. Definitely will purchase again. I love the sophisticated yet sensible smell doesn't overpower. In my perception it is a unisex scent as I am a woman and bought for myself.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products