SKU: 11346969927

Mouse IgG2C, His tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IgG2C, His tagProduct Specification Species Mouse Synonyms Immunoglobulin heavy constant gamma 2C, Ighg2c Accession F6TQW2 Amino Acid Sequence Protein sequence (F6TQW2, Ile97 Ser330, with C His tag) IEPRVPITQNPCPPLKECPPCAAPDLLGGPSVFIFPPKIKDVLMISLSPMVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGFLPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKSTWERGSLFACSVVHEGLHNHLTTKTIS Expression System HEK293 Molecular

Product Specification


Species Mouse
Synonyms Immunoglobulin heavy constant gamma 2C, Ighg2c
Accession F6TQW2
Amino Acid Sequence

Protein sequence (F6TQW2, Ile97-Ser330, with C-His tag) IEPRVPITQNPCPPLKECPPCAAPDLLGGPSVFIFPPKIKDVLMISLSPMVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGFLPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKSTWERGSLFACSVVHEGLHNHLTTKTIS

Expression System HEK293
Molecular Weight Predicted MW: 27.8 kDa Observed MW: 26, 30, 34 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. IgG is the most common type of antibody found in blood circulation. IgG molecules are created and released by plasma B cells. Each IgG antibody has two paratopes. Antibodies are major components of humoral immunity. IgG is the main type of antibody found in blood and extracellular fluid, allowing it to control infection of body tissues. By binding many kinds of pathogens such as viruses, bacteria, and fungi, IgG protects the body from infection. In mice, the IgG subclasses are defined as IgG1, IgG2a/c, IgG2b, and IgG3. The IgG2c allele is expressed (instead of IgG2a) in certain inbred mouse strains, e.g., C57BL/6, C57BL/10, SJL, and NOD.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 11346969927

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
andrew
Boise, US
★★★★★ 4
Comfortable, high-rise air mattress with built-in pump
Style: 22", Color: Grey, Size: Queen
The Intex Dura-Beam 22-inch Queen air mattress is one of the better inflatable beds I've used. The built-in pump is very convenient — no need for an external pump or battery-powered inflator. It inflates to full firmness in a few minutes and deflates just as quickly. The 22-inch height makes it easy to get in and out of, similar to a regular bed height. The plush comfort top adds a softer surface feel. The 600 lb weight capacity is reassuring for heavier users or couples. I've had guests sleep on this for multiple nights and they reported sleeping well. It held air overnight without significant deflation. My only note is to store it carefully to avoid punctures from sharp objects. Overall a great value for guests or camping.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
A
Verified Purchase
Adimil Barrio Martinez
New York, US
★★★★★ 5
Very good
Style: 18", Color: Grey, Size: Queen
I recently purchased this inflatable mattress from Amazon, and I’m honestly very impressed with the quality and comfort. It inflated quickly and was very easy to set up. The material feels durable and strong, and the mattress stayed fully inflated throughout the entire night without losing a
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
M
Verified Purchase
Monica Grant
Waukegan, US
★★★★★ 5
This is a very good air mattress
Style: 13”, Color: Grey, Size: Twin
I love this mattress so much I work overnights and I needed something to sleep on so I bought this mattress and it was the best mattress ever it’s so comfortable I purchased it Dec 24th2025 and it’s now starting to deflate I can’t find any holes in it but I still use it. I’m not gonna get rid of it because I can still sleep on it I just need to inflate it two times throughout the night it doesn’t bother me because it’s so comfortable. I’m not gonna lie I did purchase another one. But I’m 125 lb but the grands can sleep on it when they stay over so I will be keeping it. This is a really good air mattress well worth your money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
T
Verified Purchase
Thomas j
Whiting, US
★★★★★ 5
Decent air mattress if you take care of it
Style: 22", Color: Grey, Size: Queen
I’ve been buying this air mattress, and its previous model, for the last four years. I used to go camping and attend festivals about six times a year, and I wasn’t particularly nice to my air beds. Most of the time I didn’t fold them back up neatly or put them in the storage bag. I’d just deflate them, throw them in the car, and head to the next event. Even with that treatment, they held up surprisingly well. I was nervous about buying the new version with the redesigned inflate/deflate module, but on a whim I decided to give it a try. I used it during a five-night camping trip near Tygh Valley, Oregon at the end of May 2026, where temperatures ranged from about 85°F during the day to around 40°F at night. Did it lose some air over the weekend? Yes. Was it enough to bother me? No. In fact, over the entire five-night trip, I only had to add air once. Considering the temperature swings, I was impressed with how well it held up. The new model does seem to take a little longer to deflate than the older versions, but that’s a minor complaint. Overall, I’m very happy with it. I’ve had good luck with these mattresses over the years, and this new version seems just as solid as the previous model. I would absolutely recommend this mattress and will continue buying this model when it’s time to replace mine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
S
Verified Purchase
smarch104
New York, US
★★★★★ 5
Better than our actual mattress!!
Style: 22", Color: Grey, Size: Queen, Style: 22", Color: Grey, Size: Queen
Purchased for company to stay with us in our apartment. I honestly had no idea they made air mattresses this tall until I saw a friend with one! My husband and I tested it out last night. We were both really impressed! 1. Really easy to inflate! First time having an internal air pump. No more forgetting the pump! The motor wasn’t nearly as loud as our previous air pump! I was able to talk to my husband and he could still hear me over the pump running. 2. Really comfortable and supportive! We chose not to inflate it fully so it contoured to our bodies better. We slept on the mattress with no sheets and I wasn’t able to feel the creases in the top which was nice. No issues with sagging and we both didn’t wake up smooshed in the middle. My husband got up in the middle of the night and I didn’t notice. So movement of the mattress is minimal! Easy to get on and off with the 22” height. 3. Easy to deflate! We followed the instructions for folding and we got it in the storage bag with no issues. Just make sure all of the air is out before you fold it. 4. High quality! We had both of our small dogs on this with us. I was afraid of their nails poking a hole but so far so good! Only a little bit of air leaked out but it could’ve been the material stretching out during the night. Cons: The pump does not shut off automatically when inflating or deflating. So keep an eye on it so it doesn’t overfill. The mattress does get cold at night. My husband and I both mentioned that in the morning. I had to roll up in my blanket to stay warm. I’ll try sheets on next time. In the summer it might not be that big of an issue. Ours came with one patch. Hopefully we won’t need to use it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026

recommand products