SKU: 11689938172

H5N1 HA (A/Hong Kong/483/97) His Tag Protein

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

H5N1 HA (A/Hong Kong/483/97) His Tag ProteinProduct Specification Species H5N1 Antigen HA Hemagglutinin Synonyms Hemagglutinin, HA Accession O92930 Amino Acid Sequence Ser405 Val520, with N terminal 8*His HHHHHHHHGGGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV Expression System HEK293 Molecular Weight 72 80 43 55 25 30kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species H5N1
Antigen HA/Hemagglutinin
Synonyms Hemagglutinin, HA
Accession O92930
Amino Acid Sequence

Ser405-Val520, with N-terminal 8*His

HHHHHHHHGGGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV


Expression System HEK293
Molecular Weight

72-80 43-55 25-30kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Michal Lazniewski, M. et al. (2018) Briefings inFunctional Genomics 17:415.

2. Sriwilaijaroen, N. and Suzuki, Y. (2012) Proc. Jpn. Acad. Ser. B. Phys.Biol Sci. 88:226.

3. Chang, Y.J. et al. (2021) Sci Rep 11:8637.


Background

Neuraminidase (NA) and hemagglutinin (HA) are major membrane glycoproteins found on the surface of influenza virus. Hemagglutinin binds to the sialic acid-containing receptors on the surface of host cells during initial infection and at the end of an infectious cycle. Hemagglutinin also plays a major role in the determination of host range restriction and virulence. As a class I viral fusion protein, hemagglutinin is responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization either through clathrin-dependent endocytosis or through clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.




Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 11689938172

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gary Hugo
New York, US
★★★★★ 4
Definitely not indestructable
Size: Medium/Large, Color: Dog Ness Monster - Large, Size: Medium/Large, Color: Dog Ness Monster - Large
I have a 1-year-old toy fox terrier (Rocky, pictured). He has been chewing on this toy for seven months now; it is one of his favorites. He has been unable to seriously damage the "ocean" portion of this toy, but as you can see from the provided image, the sea serpent has not faired that well. It is missing its snout and smaller portions of the humps. My guess is that the advertiser images showing much larger dogs with "like new" versions of the toy are just that...NEW AND UNCHEWED. I have not had to clean up bits of this toy from my floor, so I assume Rocky has been swallowing them. My hope is that the yellow material of the serpent is not chemically dangerous when exposed to digestive fluids. Rocky easily destroys plush toys in a matter of days if not hours and, consumed pieces of a small microfiber blanket that he liked to toss around and play tug-of-war with (past tense as he destroyed it and has since been trashed after I began finding feces-stained undigested pieces of it lying around). Since this toy has survived seven months and has remained recognizable, I have to agree it is durable. Just beware, if my small toy fox terrier can damage the toy as pictured, expect your large breed chewer to do similar or worse damage. Also, the toy is very heavy! When Rocky drops it down a flight of stairs, it makes a MAJOR thud at the bottom, and sometimes makes me wonder if it might crack the large tile at the bottom. I cautiously recommend the product. Note the yellow frisbee in Rocky's picture. It is only a few months old and surprisingly has not suffered any chew damage despite substantial abuse. It appears to bend in the wind like a proverbial reed, evading damage by yielding to pressure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 5, 2024
K
Verified Purchase
Kristina Lynch
Chelsea, US
★★★★★ 5
They were tough, but not mower blade tough
They were holding up well for my doggy that eats and destroys everything. He was sad when daddy didn't see it in the yard when he mowed. Does not hold up to mower blades sadly enough lol.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
A
Verified Purchase
A. Blake
Draper, US
★★★★★ 5
Tough, Durable, and Great for Heavy Chewers
The Feeko Heavy Duty Dog Rope Toys (2-pack) have been a great addition for my dog, who is a large breed and absolutely destroys most toys within days. These ropes have held up far better than expected and have become a go-to for daily tug-of-war sessions. The ropes are thick, tightly woven, and feel genuinely sturdy. Even with constant chewing and pulling, they’ve shown very minimal fraying so far. My dog loves grabbing both ends for tug games, and I like that it keeps him engaged and active. Another nice bonus is the teeth-cleaning benefit. While it’s not a replacement for dental care, the fibers definitely help reduce some buildup as he chews and plays, which is a nice added perk. The size is also appropriate for medium to large dogs—easy for them to grip without being too small or flimsy. Having two ropes in the pack is great for rotation or multi-dog households. The only thing to note is that, like all rope toys, they’re not truly “indestructible.” Very determined power chewers will eventually cause wear over time, so supervision is still recommended. Overall, this is a durable, well-made set of dog rope toys that holds up well for aggressive chewers and provides great value for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
P
Verified Purchase
Paul Bowles
Los Angeles, US
★★★★★ 5
Fun For Your Dog
My Dachshund loves tug of war ropes. Besides playing with them, he likes to chew on them. Maybe these ropes are indestructible with large dogs, but we've had them less than a week and he's already managed to fray knots slightly on both ropes. If it takes him 2+ years to destroy them like his last one, money well spent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 9, 2026
J
Verified Purchase
Jessica Bowling
San Leandro, US
★★★★★ 4
Great value item!
This is a good quality chew toy for most dogs. Our Pitt loves it. Over time, it does shred in little patches of strings. The product was as specified. It has a great value for the money. Our first one lasted about 2 months with a puppy Pitt. We purchased a 2nd.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2026

recommand products