SKU: 13075982961

Human ADAM23 Protein, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ADAM23 Protein, His tagProduct Specification Species Human Synonyms Disintegrin and metalloproteinase domain containing protein 23, ADAM 23, Metalloproteinase like, disintegrin like, and cysteine rich protein 3 (MDC 3), MDC3 Accession O75077 Amino Acid Sequence Protein sequence (O75077, Ser60 His585, with C His tag)

Product Specification


Species Human
Synonyms Disintegrin and metalloproteinase domain-containing protein 23, ADAM 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3 (MDC-3), MDC3
Accession O75077
Amino Acid Sequence

Protein sequence (O75077, Ser60-His585, with C-His tag) SRPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEIHYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDEKSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKYLELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDQIDITTNPVQMLHEFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYGLPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHCSDGPCCNNTSCLFQPRGYECRDAVNECDITEYCTGDSGQCPPNLH

Expression System CHO
Molecular Weight Predicted MW: 61.2 kDa (pro) & 34.9 kDa (mature) Observed MW: 40-50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

ADAM23 (A Disintegrin And Metalloproteinase 23) is a member of the ADAM family, known for its roles in cell adhesion and signaling. Unlike other ADAMs, it lacks proteolytic activity but interacts with integrins and extracellular matrix proteins, influencing neuronal development and synaptic plasticity. ADAM23 is highly expressed in the brain and has been linked to epilepsy and neurodegenerative disorders. It also plays a role in cancer progression, where its dysregulation affects tumor cell migration and metastasis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13075982961

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
DKMI
Grantham, US
★★★★★ 5
Woah, Shimmer!
Color: Late Autumn, Color: Late Autumn
I love cute little things like this with the spray bulb. They’re fun gifts. My daughter likes to shimmer sometimes. She kind of overdid it the first time. It does t take much to get a sparkly, fine shimmer. The photos are a bit exaggerated on the product page. You don’t have to “paint” your skin with it. It’s an easy application, and when used right really provides a nice accent. It’s light and has a quality look and feel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2026
K
Kindle Customer
Lake Worth, US
★★★★★ 5
So pretty!
Color: Late Autumn
This shimmer is beautiful! It applies smoothly and evenly and it sparkles absolutely beautifully. You can do one spritz for a very light coverage or a few to really glow! I love the applicator - makes me feel fancy. It was a little bit sticky at first but it dries quickly and isn't sticky after that. It's a really great product to brighten up your look. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
A
Aria
Cuba, US
★★★★★ 5
This is such a fun little product.
Color: Diamond White
This is such a fun little product. The shimmer is really pretty and fine, not chunky or glittery in a bad way. It gives a nice glow without looking overdone. Super easy to apply and a little goes a long way. I’ve used it on my face and collarbones and it looks great in different lighting. For the price, I’m honestly impressed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026
I
Inspector Gadget
Bozeman, US
★★★★★ 5
Glitter Puffs
Color: Late Autumn, Color: Late Autumn
*Poof* and then there was glitter. Boko Highlighter Powder Spray, Body Shimmer Spray for Glitter Highlighter Makeup makes it as easy as squeezing a bulb. The biggest part of the assembly of the product is to male sure you remove the plastic cap and the rubber tipped end. If you miss either the spray will seem to not work. Once properly set up the powder spray bottle only takes a modest squeeze to dust the skin with instant glitter and glory. I love the look, the easy to use spray, and the bottle itself which has a simple but elegant feel to it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2025
R
Regular Person
Chelsea, US
★★★★★ 5
Extremely fine shimmer- the air bulb works well for application- Even and controllable
Color: Late Autumn
This is a great way to apply a very fine sparkle. The shimmer is very very finely ground and it sprays out evenly with this air bulb. It does have a lid so there's no chance on it getting everywhere unless you leave the lid off. It also comes with a little plug in the hole so there's two mechanisms there to keep the glitter in the bottle when not in use it's very easy to use and apply and the spray pattern is very even. I got the golden shimmer which looks great with a tan or if you have warmer undertones in your skin. It doesn't require any sort of setter or glue + doesn't have any fragrance. It's a small bottle so it doesn't take up a lot of room.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025

recommand products