SKU: 13364544562

Mycobacterium tuberculosis fbpB/Ag85B Protein, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mycobacterium tuberculosis fbpB/Ag85B Protein, His TagProduct Specification Synonyms Diacylglycerol acyltransferase mycolyltransferase Ag85B, DGAT, 30 kDa extracellular protein, Acyl CoA: diacylglycerol acyltransferase, Antigen 85 complex B (85B; Ag85B), Extracellular alpha antigen, Fibronectin binding protein B (Fbps B), MT1934 Accession P9WQP0 Amino Acid Sequence Protein sequence (P9WQP0, Phe41 Gly325, with N His Tag)

Product Specification


Synonyms Diacylglycerol acyltransferase/mycolyltransferase Ag85B, DGAT, 30 kDa extracellular protein, Acyl-CoA:diacylglycerol acyltransferase, Antigen 85 complex B (85B; Ag85B), Extracellular alpha-antigen, Fibronectin-binding protein B (Fbps B), MT1934
Accession P9WQP0
Amino Acid Sequence

Protein sequence (P9WQP0, Phe41-Gly325, with N-His Tag) FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG

Expression System HEK293
Molecular Weight Predicted MW: 32.3 kDa Observed MW: 35-43 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Ag85B is a major secreted antigen and mycolyltransferase of the Mycobacterium tuberculosis complex. This multifunctional enzyme plays a central role in constructing the unique mycobacterial cell wall. As part of the Ag85 complex, it catalyzes the transfer of mycolic acids—long-chain fatty acids—onto the arabinogalactan-peptidoglycan matrix, forming the essential mycolyl-arabinogalactan-peptidoglycan complex (mAGP). This creates the robust, hydrophobic outer membrane critical for pathogenicity and antibiotic resistance. Due to its high immunogenicity, Ag85B is also a leading candidate antigen in several tuberculosis vaccine strategies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13364544562

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Theresa
West Palm Beach, US
★★★★★ 5
Great napkins
Size: 200 Count (Pack of 1)
I keep ordering these BOUNTY PAPER NAPKINS because their versatility, durability foldability appearance and size; these are all great attributes of these napkins. I don't use them for bathroom use but on occasion I do put water on a couple of them to cool my face off which is awesome because they don't tear with that much water as I put on them. The only thing I would suggest for BOUNTY to change is the roughness and thickness of the napkins. They're a little rough not so rough to where I can't stand them but if they were just a little bit softer, not much just a tad bit. Maybe also a little bit thicker. Besides that they're awesome and worth the money
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
S
Verified Purchase
Senior Moments
Belleville, US
★★★★★ 4
Kinda Spendy, good quality
Size: 200 Count (Pack of 1)
Bounty-excellent quality. love that they make them in half sized sheets. price is more, but still, if you need really good paper towels, this is the brand to get. cheaper ones get used up quicker.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
J
Verified Purchase
Jody R.
Carnegie, US
★★★★★ 5
Soft, strong, great value
Size: 200 Count (Pack of 1)
Great napkins, strong, absorbent, and in a reasonably priced bundle, great value and delivered to your door...what could be better!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
C
Verified Purchase
ColleenRN
Dallas, US
★★★★★ 5
Great price! Great Paper towel!
Package Size Name: XXL, Size: 150 sheet (Pack of 2)
These Amazon brand paper towels are great! They are the multi tear size, which is perfect for different uses. The price is good and they clean windows and glass wonderfully. Softness is so so, but if you don’t have an issue with that, then these are a great buy! I definitely recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
H
Verified Purchase
HD813
Cuba, US
★★★★★ 5
Strong, absorbent and a good price!
Package Size Name: XXL, Size: 150 sheet (Pack of 12)
These are good paper towels. Not thin at all. Strong, absorbent and capable of cleaning as well as the 'name' brand paper towels but at a much better price. I'm happy with them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026

recommand products