SKU: 13797946226

Ephrin B3 Fc Chimera Protein, Human

Sale price$225.00 Regular price$250.00
Save 10%

Pay in installments of $62.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 21 - Aug 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Ephrin B3 Fc Chimera Protein, HumanProduct Specification Species Human Accession Q15768 Amino Acid Sequence Leu28 Ser224, with C terminal Human IgG Fc

Product Specification


Species Human
Accession Q15768
Amino Acid Sequence

Leu28-Ser224, with C-terminal Human IgG Fc

LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 60-65kDa (Reducing)
Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

 Ephrin-B3 binds HSPGs on HEK-293T, HeLa, and CHO cells, where heparin blocks binding to HEK-293T cells independently of Eph receptors, and a heparin/HS-binding domain in ephrin-B3 was identified outside of the Eph-receptors binding domain. The two positively charged residues, Arg178 and Lys179, in the ephrin-B3's juxtamembrane region is important for heparin/HS binding. Changing the corresponding amino acids in the non-heparin binding ephrin-B1 to positively charged residues gave heparin binding. Ephrin-A3 also binds HS, where Lys176 corresponds to Lys179 in ephrin-B3. Ephrin-B3 binding to lymphocytes and lymphoma cell lines may also depend on other residues near the transmembrane domain, in particular Arg188 which is less affected by heparin, suggesting several mechanisms for ephrin-B3 binding to cells. Functional studies revealed that ephrin-B3 binding to cells induces signaling, influencing both cell rounding and spreading.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13797946226

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michael Thurmond
Cuba, US
★★★★★ 5
Perfect
Number of Items: 4
My wife was thrilled to get this wider and clear heat resistant tape. Uses it with her sublimation projects
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
O
Verified Purchase
omnireader
Whiting, US
★★★★★ 5
Great for purpose.
Number of Items: 4
Excellent product for hanging items on a grid wall at for sale at craft shows.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 30, 2025
A
Verified Purchase
Amazon Customer
Cuba, US
★★★★★ 4
Almost perfect
Number of Items: 4
Works ok, and no color to bleed onto sublimation surfaces. Not very sticky making for easy removal but sometimes a bit of a challenge to get to lay down.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 28, 2023
R
Verified Purchase
ReadingWriteNow
Boise, US
★★★★★ 5
They work very well.
Number of Items: 2
I love these. I use them to wrap my tumbler before sublimating them in my sublimation oven. They work every well to let me see the process so I don’t scorch my design.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 16, 2025
T
Verified Purchase
The Two Hsus
Lake Worth, US
★★★★★ 5
Best out of all other heat tapes!
Number of Items: 6
It is extremely weird how excited I became when trying this tape out for the first time. I can't speak for all of the blue heat tapes but this one in particular is all sorts of great to use. Thicker, easier to tear, stronger adhesive than the brown and clear heat tapes I've tried. I started with the clear because I was afraid of the other colored tapes leaving marks on my substrates. The clear tape was a good amount of thickness and easy to tear and use but the adhesion was terrible. I would wrap it around the rim of tumblers, fold it down into the inside of the tumbler and it would pop right back up. Forget using it on any fabrics, did not hold sublimation sheets down to totes, shirts, mousepads, at all. The brown tape I used had better adhesion but was thin and stretchy? floppy? Didn't know this was even an annoying thing until I moved on to this blue tape and was just blown away. Still blows me away how it was cheaper than the other two kind but is the thickest and best gripping of them all. So far it does not leave any marks on any of my items. I'm so impressed by this tape that I still NOTICE it everytime it's tearing off perfectly or holding my things together so well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 9, 2023

recommand products