Pay in installments of $70.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 21 - Aug 26
For Your Every Summer RSVP, with Code: SUMMER15
Description
Biotinylated LILRA3 His&Avi Tag Protein, HumanProduct Specification Species Human Synonyms LILRA3, ILT6, LIR4, CD85e Accession Q8N6C8 Amino Acid Sequence Gly24 Glu439, with C terminal 8*His&Avi tag
Product Specification
| Species | Human |
| Synonyms | LILRA3, ILT6, LIR4, CD85e |
| Accession | Q8N6C8 |
| Amino Acid Sequence | Gly24-Glu439, with C-terminal 8*His&Avi tag GPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGEGGGSHHHHHHHHGLNDIFEAQKIEWHE |
| Expression System | HEK293 |
| Molecular Weight | 68-75kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Biotin |
| Tag | Avi Tag, His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Knight J S. et al. (2017) Activated signature of antiphospholipid syndrome neutrophils reveals potential therapeutic target. JCI Insight. 2(18): e93897. |
Background
Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3) is also known as CD85 antigen-like family member E (CD85e), immunoglobulin-like transcript 6 (ILT-6) belongs to a family of leucocyte receptors. LILRA3 lacks a transmembrane domain and it is highly homologous to other LILR genes, and can bind human leukocyte antigen (HLA) class I. The biologic role of the LILRA3 molecule and the nature of its ligand are not known. LILRA3 can bind with high affinity to the surface of monocytes, leading to abolish LPS-induced TNF-alpha production by monocytes. It can be detected in B-cells, natural killer (NK) cells, peripheral blood monocytes and lung. LILRA3 transcripts are markedly upregulated in neutrophils from patients with antiphospholipid syndrome (APS). Some polymorphisms of the LILR genes are reported to be associated with susceptibility to diseases such as rheumatoid arthritis and multiple sclerosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 16 reviews
Sort
Product Reviews
★★★★★ 5
Love them!
Color: White-cooling Basic, Size: Queen(Pack of 2)
Love them! After 10 years with our MyPillows, they finally lost their fluff. The reviews I read of the MyPillows of today were not good; they didn’t have as much filling as they used to. These pillows remind me of how fluffy our new MyPillows were 10 years ago!! You sink right into them and can mush them however and they stay. These are way cheaper than the Coop and it’s the same concept; add or remove the filling as needed. The cooling side is a huge plus too! You won’t be disappointed with these pillows!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
★★★★★ 5
Super comfortable!!!!
Size: Queen - Pack of 2, Style: Medium, Configuration: Pillow
They are super soft and large; they come vacuum-sealed and expand very quickly. They aren't heavy, and they are incredible for sleeping and watching TV in bed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
★★★★★ 5
Comfort and Quality
Size: Queen - Pack of 2, Style: Medium, Configuration: Pillow
These pillows are very comfortable. They hold their shape well throughout the night and have greatly improved my sleep. Plus, the quality of the materials is excellent. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
★★★★★ 1
Terrible pillows
Size: Queen - Pack of 2, Style: Medium, Configuration: Pillow
These pillows might be fine if you need them for a decorative sham, but definitely NOT to sleep on. They are super lumpy and soft, days after taking them out of package. It seems like there are just bunches of cotton strips in a row that are hard to fluff. They are also dark in some areas, so it looks like the pillow is stained, when in fact it's whatever material the stuffing is. I can't return them because they won't fit back in the box. Super disappointing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026
★★★★★ 5
Comfortable from the first night
Size: Queen - Pack of 2, Style: Medium, Configuration: Pillow
I found them comfortable and with good support for the head and neck. They are wide in size and feel soft when lying down. After several days of use they continue to retain their shape without problem.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026