SKU: 17338281192

Human BRD4 Protein, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human BRD4 Protein, His tagProduct Specification Species Human Synonyms Bromodomain containing protein 4, Protein HUNK1, HUNK1 Accession O60885 Amino Acid Sequence Protein sequence (O60885, Ser42 Glu168, with N His tag) STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE Expression System E. coli Molecular Weight Predicted MW: 16. 9 kDa Observed MW: 15 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g

Product Specification


Species Human
Synonyms Bromodomain-containing protein 4, Protein HUNK1, HUNK1
Accession O60885
Amino Acid Sequence

Protein sequence (O60885, Ser42-Glu168, with N-His tag) STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEE

Expression System E.coli
Molecular Weight Predicted MW: 16.9 kDa Observed MW: 15 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Liquid
Storage Buffer

Supplied as a 0.2 μm filtered solution of 50mM Tris-HCl (pH7.5), 300 mM NaCl, 5% glycerol.

Stability & Storage

12 months from date of receipt, -20℃ as supplied.

Background

Bromodomain - containing protein 4 (BRD4) is a pivotal protein in epigenetic regulation. As a member of the BET (bromodomain and extra - terminal domain) family, it binds to acetylated lysine residues on histone tails via its bromodomains. This binding enables BRD4 to recruit transcriptional co - activators, such as the positive transcription elongation factor b (P - TEFb), and facilitate the transition from transcription initiation to elongation. In normal cells, BRD4 is involved in cell cycle progression, differentiation, and development. However, in cancer, aberrant BRD4 function is frequently observed. It drives the over - expression of oncogenes, fueling tumor cell growth, proliferation, and survival.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17338281192

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
Z
Verified Purchase
Zoltare
Whiting, US
★★★★★ 5
Great toy
Color: Red
She LOVES it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2025
S
Verified Purchase
Samantha
New York, US
★★★★★ 5
Dogs love them!
Color: Blue
I had to by one for each one of my dogs after purchasing the first one for the new puppy. All three, pink, red, and blue are the same size fyi. Dogs love them and they seem very durable for my heavy chewers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2025
G
Verified Purchase
Gislaine Cavassini
Boise, US
★★★★★ 5
incredible
Color: #03 Champagne
Simply wonderful! The fragrance is delicate and sophisticated, leaving the skin gently scented all day long. The glitter has an elegant shine and is not exaggerated, perfect for parties or special events. The application is super practical, spreads easily and the fixation is great. I recommend it to those who want a touch of glamour and brightness with an incredible smell!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
J
Verified Purchase
Jenn May
Grantham, US
★★★★★ 5
90’s me be jealous 🥹
Color: #04 Bronze
26 years later, here I am- the sparkling unicorn of an adult the late 90’s child version of myself DREAMED of while coating ✨EVERYTHING✨ in glitter and shimmer. Only now, I have an Amazon card and the impulse control of a toddler, so I sparkle now 🤩. Am I 40 years old? Absolutely. Did my kindergarteners at school ask why I sparkle now? Absolutely. Did my mid-life crisis self lie to them, and say because I’m a magical unicorn? Absolutely. Did they believe me? ABSOLUTELY. 10/10 recommend, but only if you too want to live your best magical unicorn life! Technical notes- the smell is light and lovely. It dries without a “feel” so I forget I even have it on. The shimmer is noticeable, but not like I rolled in glitter. I’m enjoying the bronze glimmer color, but I’m sure will be back soon for more. I could easily spray more if I wanted to be more blatant with my attention seeking. I will absolutely be using this stuff from now until I’m in my grave with no shame! Fantastic all around 🤌
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2025
A
Verified Purchase
amber
San Leandro, US
★★★★★ 1
super cute until it stops working
Color: #03 Champagne
worked really great for about 10 sprays before it clogged permanently! tried to clean out the spray mechanism but it still didn’t work.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026

recommand products