SKU: 18299754135

FKBP12 His Tag Protein, Human

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FKBP12 His Tag Protein, HumanProduct Specification Species Human Synonyms FKBP 12, FKBP 1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE Accession P62942 Amino Acid Sequence Met1 Glu108, with C terminal 8*His Tag MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEHHHHHHHH Expression System E. coli Molecular Weight 13kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms FKBP-12, FKBP-1A, FKBP1, FKBP12, PKC12, PKCI2, PPIASE
Accession P62942
Amino Acid Sequence

Met1-Glu108, with C terminal 8*His Tag MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEHHHHHHHH

Expression System E.coli
Molecular Weight

13kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Curr Genet. 2021 Jun;67(3):383-388.
2. Genetics. 1999 Mar;151(3):935-44.

Background

FKBP12 associates with several large protein complexes, including the multi-drug resistance pump and the ryanodine, inositol trisphosphate (IP3)and the type I TGF-β receptor. FKBP12 was originally identifed as a FK506 binding protein. FK506 is a clinically used immunosuppressant derived from Streptomyces tsukubaensis. The FK506–FKBP12 binary complex inhibits the protein phosphatase calcineurin, thereby preventing T lymphocytes from producing interleukin-2 in mammals.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 18299754135

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Hailey
Draper, US
★★★★★ 4
YA historical murder mystery
Format: Hardcover
3.5 stars What I Liked: -Character voices seems to be once of Lee's writing strengths. From the start of the book, Gemma and May's voices sparkle on the pages. Gemma herself seemed to be a little stronger of a character, but I think that's because she had a more spunky, active personality. -The positive sister relationship made me happy. So often, I feel like siblings don't appear in fiction, or if they do they just fight with each other. I liked how all of the Chow sisters worked together, and the positive family relationships in general. What I Struggled With: -Something about the mystery fell flat and I was left wanting more. I can't pin my finger on exactly why I felt that way, but it might have had to do with how Gemma and May solved the murder. They honestly don't really see it coming or put together many clues until the end. When the murderer revealed everything, I could see the crumbs that had been foreshadowed--but I think that they needed something /more/ to make them work. - I'm glad that Gemma and Freddie didn't end up together. I'm not entirely sure of what the age difference was, but since he'd already graduated med school and seemed to have been a doctor for a while, I'm guessing it was fairly large. Because of the age gap, I was a little uncomfortable with the relationship that seemed to grow between them. I don't think it would have bothered me if just Gemma had a crush, but Freddie seemed to like her as well. But as I already said, they don't end up together. Overall: I enjoyed Kill Her Twice. But I was a little disappointed in mystery side of it. Yes, Gemma and May are solving a murder, but the mystery seemed to fall a little flat. However, Lee's abilities in writing characters shine. Cautions: three instances of swearing; one blasphemy; light romance; one kiss; brief, moderate violence; non-descriptive mentions of poisoning; two minor characters are discovered to be gay, referenced briefly; an unmarried character is discovered to have been pregnant, which is referenced multiple times ; several Bible verses are taken out of context and twisted (I received an eARC through NetGalley. All thoughts are my own.)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 25, 2025
G
Gigous
New York, US
★★★★★ 5
Hollywood Murder Mystery
Format: Hardcover
This book is a captivating murder mystery set in 1932 Los Angeles. Chinese American sisters Gemma and May have a lot to worry about their mother is pregnant and their father is away getting treatment for an illness, then they have to run the family flower selling business, and their home in Chinatown will likely be destroyed to build Union Station. The last thing they needed was to find the body of Hollywood starlet and May’s friend, Lulu Wong. Not trusting the police to investigate especially when the police frame a homeless man from Chinatown, Gemma, May and their little sister Peony try to solve the murder themselves. They start looking into the people in Lulu’s life and who would have a motive to kill her. Another actress, a co-star, a rich man who hates Chinatown, a possible secret boyfriend, Lulu’s agent, extras in the film, and her new film’s director are all suspects. Gemma comes up with schemes to find information, May starts working on the movie Lulu was filming, and Peony talks with Lulu’s little sister. They also get help from Wallace, a young entomologist, and Freddie, a young doctor. As the sisters uncover more secrets, more the dangerous their investigation becomes and they are putting a target on their backs. With so many suspects and red herrings, will the sisters find Lulu’s killer? This story has a fast pace with lots of twists and big reveals in the sisters’ investigation. The story is told in first person alternating between Gemma and May. Gemma is a big dreamer with lots of ideas and is a bold, risk taker. May, the oldest sister, is more practical, cautious, and careful. The other characters are great and well written. The 1932 Los Angeles setting is well researched and described. The story has a bit of romance between May and Wallace and a flirtation been Gemma and Freddie. The ending wraps up the story, we learn Lulu died and who was her killer and the next step in the sisters’ lives. The cover is beautiful and I really enjoyed this book. Fans of historical mysteries like the Stalking Jack the Ripper series, the Jane Austen Murder Mystery series, and the Burning Cove series would like this book. Another excellent read by Stacey Lee.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2024
L
Lauralee
Alexandria, US
★★★★★ 4
A Fun Historical Mystery!
Format: Kindle
In 1932, the famous movie star Lulu Wong was murdered. However, the police arrested an innocent man for the crime. The Chow sisters—May, Gemma, and Peony— believe that because Lulu Wong was Asian, her case was not handled fairly. They decide to investigate the case to find the real killer. As they investigate, the sisters realize that they are in great danger because the killer knows that they are investigating him and he wants to stop them. Even though the synopsis named three main characters, there are only two narrators—May and Gemma. Peony is rarely mentioned and does very little investigating in this book. Peony mostly likes playing basketball and reading. She spends most of the time taking care of her pregnant mother. May and Gemma are the ones that do the real investigating. Gemma is very reckless and impulsive, but May is hesitant and reluctant. May thinks more about her family’s reputation and her responsibilities for her family. Therefore, Gemma has more freedom and independence. I found both Gemma and May to be very smart. I also like how they teamed up to solve the mystery. Therefore, they make a very fun team. Overall, this book is about family, racism, and dreams. The main message of this book is to follow your heart. I liked all the characters. I found them to be very complex and realistic. I did find the book to move at an incredibly slow pace. I also thought that the mystery was drawn out. Nevertheless, I like the setting of 1930s Chinatown. Kill Her Twice was an entertaining cozy historical mystery that is perfect for a lazy afternoon! I recommend this book for fans of June Hur, Joan He, and Sherry Thomas! (Note: I read an ARC copy of this book in courtesy of Netgalley.)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 28, 2025
Y
Verified Purchase
Young Adult Literature Fan!
Dallas, US
★★★★★ 5
Great Young Adult Read!!
Format: Paperback
Copper Sun is a fantastic and interesting read. It brings the reader into the main character, Amari's life and the obstacles she had to overcome. This book is hard to put down with the rich language and the exciting plot! Reading this book makes the reader feel alive and excited to cheer Amari on! The quest for freedom pulls at the readers heart strings. Young adult readers will relate well to this novel due to the adventure and the Amari's passion for hope and faith. Teen readers can relate to the themes of friendship, love, and death and how a young girl deals with it all. Both boy and girl readers will see this book as a new and different way to read about the historical events before the Civil War and the harshness of slavery. Young adults will love the change in main character from traditional boy protagonists, to Amari, a young girl who has to start a whole new life without family and anyone she has ever known. Draper constantly provides Amari with obstacles to overcome. The rich language and excellent character development provide readers with an exciting and thrilling read. As a reader, you will be on the edge of your seat waiting for whats next in the life of Amari in Copper Sun!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2012
L
Verified Purchase
Lee
Charlottesville, US
★★★★★ 5
Awesome Book!
This book was fantastic! I was watching NY1 one morning and some students were sharing the books they were reading this summer. One little girl shared this book and said it was the best book she'd ever read! So I bought it and noticed it had earned a Corretta Scott King Award, as well. Although it only mildly touched on the horrible institution abd acts of slavery, it was written in a way that a young reader could understand without it being extremely graphic. I am a kindergarten teacher in an African American community and while I cannot use it as a Read Aloud for my students, I will absolutely ask my principal if she can purchase a copy for each upper grade teacher to be used for our daily, morning, read aloud. Our children must learn about their history because in may ways it will give them strength, perseverance and will also assist in shaping their future. Sharon Draper did an amazing job!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2016

recommand products