SKU: 18435229301

TREM2 His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TREM2 His Tag Protein, HumanProduct Specification Species Human Antigen TREM2 Synonyms TREM 2, Triggering receptor expressed on monocytes 2, PLOSL2, Trem2b, Trem2a, Trem2c, Triggering Receptor Expressed On Myeloid Cells 2a Accession Q9NZC2 1 Amino Acid Sequence His19 Ser174, with C terminal 8*His HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSGGGSHHHHHHHH Expression

Product Specification


Species Human
Antigen TREM2
Synonyms TREM-2, Triggering receptor expressed on monocytes 2, PLOSL2, Trem2b, Trem2a, Trem2c, Triggering Receptor Expressed On Myeloid Cells 2a
Accession Q9NZC2-1
Amino Acid Sequence

His19-Ser174, with C-terminal 8*His HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 25-35kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Painter, M.M. et al. (2015) Mol. Neurodegener. 10:43. 2. Bouchon, A. et al. (2000) J. Immunol. 164:4991.

Background

TREM-2 (Triggering Receptor Expressed on Myeloid cells-2) is a 35 kDa type I transmembrane member of the TREM family and Ig superfamily. Mature human TREM-2 consists of a 156 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane (TM) domain, and a 35 aa cytoplasmic tail. Soluble forms of the TREM-2 ECD are generated by alternative splicing or proteolytic cleavage, and the cytoplasmic domain can be liberated by gamma-Secretase mediated intramembrane cleavage. A positively charged lysine within the transmembrane segment allows association with the signal adapter protein, DAP12 and inhibition of macrophage activation. TREM-2 is expressed on macrophages, immature myeloid dendritic cells, osteoclasts, microglia, and adipocytes. It promotes the differentiation and function of osteoclasts, the production of inflammatory cytokines by adipocytes, insulin resistance, and the phagocytic clearance of bacteria. In the CNS, TREM-2 binds to ApoE, ApoA1, and ApoB and mediates the clearance of apoptotic neurons, amyloid plaques, and cell debris following demyelination. TREM-2 also interacts with and modifies signaling through Plexin A1 on dendritic cells and osteoclasts. Mutations in TREM-2 or DAP12 are associated with the development of Alzheimer's disease and Nasu-Hakola disease (NHD/PLOSL) which is characterized by presenile dementia and bone cysts. Soluble TREM-2 is elevated in cerebrospinal fluid of patients with active multiple sclerosis (MS), and TREM-2 blockade exacerbates disease symptoms in the experimental EAE model of MS.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 18435229301

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Alesialynette
Battle Creek, US
★★★★★ 5
Great plates for the holidays and family gatherings!
Size: Extra Large (Pack of 1), Size: Extra Large (Pack of 1)
These plates are sturdy and designed to hold even the heaviest of meals without bending or folding, which is a huge plus when you're serving barbecue or pasta dishes. One of the standout features is their size; they’re large enough to accommodate generous portions, making them perfect for parties or picnics. I also appreciated the attractive design, which adds a nice touch to the table setting. Cleanup was a breeze, as they are disposable and save me from the hassle of washing up after the event. Additionally, they don’t soak through easily, so I didn’t have to worry about any leaks or messes, even with saucy foods. Overall, I highly recommend Dixie Ultra Large Paper Plates for anyone looking for a reliable and stylish disposable plate option. They combine functionality with aesthetic appeal, making them a perfect choice for any occasion!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2025
S
Verified Purchase
Sw
Alexandria, US
★★★★★ 4
Sturdy and Reliable Plates for Any Occasion!
Size: Extra Large (Pack of 1)
The Dixie Ultra Large Paper Plates are truly impressive in quality and design. They feel incredibly sturdy, living up to the promise of being 3X stronger than standard paper plates. I love the 11-inch size — it’s perfect for big, heavy, and messy meals without worrying about leaks or spills. The soak-proof coating and microwave-safe feature make them super convenient. The design is also bright and festive without being too flashy. These plates are now a must-have in my kitchen for family dinners and parties!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2025
D
Verified Purchase
Diane Z.
Lowell, US
★★★★★ 5
Strong Enough for BBQ Ribs, Pasta & Everything in Between!
Size: Extra Large (Pack of 1)
These Dixie Ultra paper plates are truly the heavyweight champs of disposable dinnerware. I grabbed them for a backyard BBQ, expecting the usual paper plate struggle—but these held up like actual dinner plates. We piled on ribs, baked beans, coleslaw, and even mac & cheese, and not a single plate buckled, soaked through, or leaked. At 11 inches, they’re large enough for full meals (and seconds!), and the cut-resistant coating means no forks poking through. They're also microwave-safe, which is great for leftovers. Whether it's dinner with kids, hosting guests, or avoiding dishes during busy weeks—these are now my go-to. Totally worth it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 20, 2025
D
Verified Purchase
Douglas E Brandel Jr
Charlottesville, US
★★★★★ 5
Size and value
Size: Extra Large (Pack of 1)
Much larger than my regular plates and they feel more sturdy than the other plates for the value of the product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
M
Verified Purchase
Marge V.
Phoenix, US
★★★★★ 5
Sturdy paper cup.
Good cup. Is not wax covered on outside but very sturdy. All cups intact during shipping.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2026

recommand products