Pay in installments of $37.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 18 - Aug 23
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Adiponectin His Tag Protein, HumanProduct Specification Species Human Synonyms Adiponectin; 30 kDa Adipocyte Complement Related Protein; Adipocyte complement related 30 kDa protein; ACRP30; Adipocyte; C1q and Collagen Domain Containing Protein; Adipose Most Abundant Gene Transcript 1 Protein; apM 1; Gelatin Binding Protein; ADIPOQ; ACDC; ACRP30; APM1; GBP28 Accession Q15848 Amino Acid Sequence
Product Specification
| Species | Human |
| Synonyms | Adiponectin; 30 kDa Adipocyte Complement-Related Protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and Collagen Domain-Containing Protein; Adipose Most Abundant Gene Transcript 1 Protein; apM-1; Gelatin-Binding Protein; ADIPOQ; ACDC; ACRP30; APM1; GBP28 |
| Accession | Q15848 |
| Amino Acid Sequence | ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNGGGSHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 36 kDa(Reducing) |
| Purity | ＞95%, by SDS-PAGE under reducing conditions |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Adiponectin(ADPN) is a hormone secreted by adipocytes that regulates energy homeostasis and glucose and lipid metabolism. Adiponectin is a new member of the family of soluble defense collagens, in hematopoiesis and immune responses. It is an important negative regulator in hematopoiesis and immune systems and raise the possibility that it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin is mapped to 3q27 and can protect the organism from systemic inflammation by promoting the clearance of early apoptotic cells by macrophages through a receptor-dependent pathway involving calreticulin. The standard product used in this kit is the product of gene recombination, consisting of 226(19-244) amino acids with the molecular mass of 36KDa after glycosylation.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy