SKU: 18779892996

EphB1 His Tag Protein, Human

Sale price$374.40 Regular price$416.00
Save 10%

Pay in installments of $104.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EphB1 His Tag Protein, HumanProduct Specification Species Human Antigen EphB1 Synonyms ELK, EPHT2, Hek6, NET Accession P54762 Amino Acid Sequence Met18 Pro540, with C terminal 10*His Tag MEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQN

Product Specification


Species Human
Antigen EphB1
Synonyms ELK, EPHT2, Hek6, NET
Accession P54762
Amino Acid Sequence

Met18-Pro540, with C-terminal 10*His Tag MEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPNQN NWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPPQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLPGGGSGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 60-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Wenqiang Wei, Shaoping Ji. Paradoxes of the EphB1 receptor in malignant brain tumors. Cancer Cell Int. 2017 Feb 8; 17:21. eCollection 2017.

Background

Eph receptors are a subfamily of receptor tyrosine kinases. Eph receptor-mediated forward and ephrin ligand-mediated reverse signalings are termed bidirectional signaling. Increasing evidence shows that Eph/ephrin signaling regulates cell migration, adhesion, morphological changes, differentiation, proliferation and survival through cell-cell communication. Some recent studies have started to implicate Eph/ephrin signaling in tumorigenesis, metastasis, and angiogenesis. Previous studies have shown that EphB1 receptor and its ephrin ligands are expressed in the central nervous system. EphB1/ephrin signaling plays an important role in the regulation of synapse formation and maturation, migration of neural progenitors, establishment of tissue patterns, and the development of immune organs. Besides, various recent studies have detected the abnormal expression of EphB1 receptor in different brain tumors. However, the underlying molecular mechanisms of EphB1/ephrins signaling in the development of these tumors are not fully understood.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 18779892996

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
jennifer
Belleville, US
★★★★★ 5
Easy tasty way to support digestive health
PSA- You need more fiber. I've been using these prebiotic fiber gummies for a while now, and overall I've had a very positive experience. The Citrus Berry Splash flavor is genuinely enjoyable, which makes them much easier to take consistently than some other fiber supplements I've tried. I also love the convenience I keep the bottle on my coffee table and have them after dinner when I watch TV. I've noticed that they help support regularity when taken consistently, and I like knowing that they contain prebiotic fiber to help nourish beneficial gut bacteria. For me, these gummies work best as part of an ongoing digestive health routine rather than as a quick solution when I'm already feeling backed up. In those situations, I personally find fiber powders to be a bit more effective. However, that's not really the purpose of these gummies—they're designed to help maintain digestive health and regularity over time, and I think they do that well. The gummies tend to stick together in the bottle, especially once I've gotten about halfway through it. I've found that storing the bottle upside down helps prevent them from clumping too much and makes them easier to grab. Overall, these are a great option if you're looking for a tasty, convenient fiber supplement that's easy to stick with long term. They've helped me maintain regularity, taste great, and are much easier to incorporate into a busy schedule than many other fiber products. I would definitely purchase them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
T
Tricia H.
New York, US
★★★★★ 5
Delicious and easy to chew probiotic gummies that also add fiber to your diet!
i just received this package of probiotic fiber gummies and can assure you that they taste terrific! The container is easy to open and includes an internal seal both to assure freshness and the safety of the product. These are individual gummies that are easy to chew and taste yummy! One flavor is citrusy and another has a berry flavor. Chewing them was not at all difficult and I did not feel like I ended up with lots of residual product stuck in my teeth. Each serving of 3 gummies provides 6 grams of fiber which is an additional benefit to the probiotics! The recommended dose is 3-6 gummies per day. As well as being flavorful and easy to chew, the addition of fiber is a great benefit for most people’s diets! I am a healthy woman of “a certain age” as the French say. I don’t have specific health problems that I know of but I am trying in general to maintain a healthy lifestyle. That was my goal in acquiring this product. This is the first day I have eaten and enjoyed these probiotic gummies. Of course I have not experienced any health benefits yet but my initial experience eating these soft gummies has been extremely positive! If you are interested in adding probiotics or fiber to your diet, I encourage you to purchase these inexpensive, delicious and easy to chew gummies!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
J
JReader
Grantham, US
★★★★★ 5
Tastes Great!
I’ve tried a lot of fiber supplements over the years, and these are honestly one of the easiest ones to stick with consistently. The biggest thing for me is that they actually taste good. The Citrus Berry Splash flavor is pleasant without being overly sweet or having that weird artificial vitamin aftertaste some gummies have. They’re soft and easy to chew too. Some fiber gummies can be oddly hard or stick to your teeth, but these have a good texture and are easy to take daily. What I really appreciate is the convenience. It’s so much easier for me to remember gummies than mixing powders into drinks all the time. I can just take them quickly in the morning or after dinner and be done with it. After using them consistently, I’ve noticed they help keep things more regular without feeling harsh or causing the kind of stomach discomfort some fiber products can. They feel gentler compared to a lot of other options I’ve tried. The large bottle is another plus. With 126 gummies, it lasts quite a while, so even though the upfront cost might seem a little high, I think the value is pretty reasonable for how long they last. I also like that they’re a simple way to add a little extra support to my routine, especially on days where my diet probably isn’t perfect. Overall, easy to take, good flavor, gentle on the stomach, and something I’ll continue buying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
J
✮ Jess ✮
Omaha, US
★★★★★ 5
Yummy and great alternative!
I’m a regular user of Benefiber powder. I add it to my protein shakes in the morning - but there are days I don’t have time to make a shake. I needed an alternative source for fiber and decided to try these. PROS: - Tasty! I really like the fruity flavor. It’s not too strong of a flavor and it leaves a decent aftertaste. - They’re easy to chew, swallow, and go down. - Container comes with 126 gummies which will definitely last a while. - Freshness is good. I’ve opened and shut the container several times over the last couple of weeks and the remaining gummies stay soft. - They work to keep me regular, which is nice because I don’t always have to have the powder. CONS: - They make my husband gassy and bloated. He isn’t used to daily fiber, so maybe it’s just going to take some getting used to.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
D
D2 Reviews
Lake Worth, US
★★★★★ 5
Great flavor, great value!
I was truly impressed with these chewable vitamins! First, they have a delightful flavor, possibly a mix of orange and raspberry, and they taste pleasantly sweet. The texture resembles that of fruit snacks rather than gummies, as they did stick to my teeth slightly, but not for long. You receive a good supply of 42 servings (with 3 chewables per serving). I did find that they contain a bit more sugar than I expected (2g), and I wish they included at least some amount of soluble fiber. However, with 6g of dietary fiber, they complement my usual supplement well. Overall, this is a great value for the money and an impressive supplement.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026

recommand products