SKU: 76398151096

FABP5 His Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP5 His Tag Protein, HumanProduct Specification Species Human Accession Q01469 Amino Acid Sequence Ala2 Glu135, with N terminal 8*His MHHHHHHHHATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Expression System E. coli Molecular Weight 17kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 20mM Tris,

Product Specification


Species Human
Accession Q01469
Amino Acid Sequence Ala2-Glu135, with N-terminal 8*His MHHHHHHHHATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Expression System E.coli
Molecular Weight 17kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid binding protein 5(FABP5), epidermis is a protein encoded by the FABP5 gene. The gene encodes a fatty acid-binding protein present in epidermal cells and was first identified as being upregulated in psoriatic tissue. Fatty acid binding proteins are a small, highly conserved family of cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. The effects of FABPs are thought to include fatty acid uptake, transport and metabolism. FABP5 has been shown to interact with S100A7.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 76398151096

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
Irv
Bozeman, US
★★★★★ 5
Entertainment for You --- Fun for your Dog
Size: 4 INCH, Pattern Name: IQ TREAT BALL 4"
I had seen a friend with this toy for her dog. I asked if I could try it for my two dogs (mini schnauzer & chihuahua/pug mix). My dogs loved it! The only way they'll stop playing with it is if you pick it up or when they finally realize there aren't anymore treats available. I now own two of the 5" (which is really 4" in diameter) and one 3". If I know I'll be gone for a while, I'll load up all 3 and they'll have more than enough food/stimulation while I'm out. I am so satisfied with these toys, I looked up the manufacturer and purchased the Large Buster Food Cube. Why? -Simply for variety. The Buster doesn't get quite as good of a following from my dogs as the ball, but it has its own advantages. The chips seen in another reviewers photo(s)..., this happened to me as well. When inspecting the three IQ Balls I have for my dogs, no chipping of the small fins as shown in the photo(s) changed the integrity of the ball. The chips will most likely happen to everyone if your dog is even somewhat of a chewer. I'm not putting these on display for family/friends to come see. They're dog toys. If your dog is a fierce chewer, only use the ball as an entertaining feeding option. The Buster Food Cube could be used permanently with the most determined chewers. Please don't be swayed by those photos. I was a little concerned when I had seen them prior to ordering. Now, I know how inconsequential those chips are and how much those photos make it appear like a potential deal-breaker. Tennis balls and the Kong toy used to be my favorites for my dogs. Now the Treat Ball and Buster Food Cube are the favorites. Treat Ball - Pros ----------------- -More fun for my dogs than the Buster Food Cube -Adjustable food dispensing - you can set it to be depleted quickly, the cube will take a lot longer, relatively Buster Food Cube - Pros ------------------------ -Holds more food -A bit more challenging than the ball -Very quiet compared to the ball (you'll experience a constant rolling until the ball crashes into your wall, furniture, etc. - nothing harmful to either) -Rarely, if ever does it get stuck (with the ball - even the larger size - you may find times when your dog has given up because it has been lost under an accommodating piece of furniture; the cube is truly too large to get trapped) -More durable than the ball - the most determined chewers will not have success destroying this toy *** If OurPets would ever make a larger sized ball (Buster Food Cube diameter), I would buy that in a second. This would keep it from being stuck as often and I would like the increased food capacity, as the cube has.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2013
A
Verified Purchase
a person
Bozeman, US
★★★★★ 5
great
Size: 4 INCH, Pattern Name: IQ TREAT BALL 4"
This ball is great for my two and a half year old border collie mix. I give his breakfast through this ball, and it keeps him occupied for 20 minutes total. The ball won't fill up a whole cup of kibble, so I have to fill it up two times. This ball takes him longer and tires him more than the Tug a Jug, which only takes him about five minutes to empty. As he empties the ball twice, he will pant and go lap on some water. It's good to see he's getting some kind of work for his food as opposed to just chomping it down from the bowl with no effort. The only downside is that a lot of times the lid gets loose even if you close it pretty secure. One time the lid came off completly as my dog was playing with it, exposing all the kibble. To prevent this I used some strength to close the lid very tight, but later I could not open it back up! It took a grown male to open it back. My dog does not chew on this ball due to the awkward shape and material(hard plastic). I and my dog have dropped this a couple of times on both laminate and wood floor, but I see no crack on the ball so far. It seems durable. Good ball to make your dog work for his breakfast or dinner. UPDATE: My dog still loves this toy. With the difficulty setting set to max, it is the slowest treat dispensing toy in my collection(buster cube, tug a jug, kong wobbler). That's good, it lets him burn off more energy. Also since the ball doesn't hold a full cup of kibble, I would pour half and the rest on his regular food bowl. I place the ball next the the bowl and give a release "OK!". Guess where my dog goes? He runs off with the ball! Even after realizing that there is food in the bowl (He puts his nose inside the bowl for a second and then goes to the ball) where he could just eat it, he perfers to get his food from the ball.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2010
F
Verified Purchase
Farley
Lexington, US
★★★★★ 4
3 considerations for IQ BALL. FUN, DURABILITY & COST to TIME VALUE
Size: 4 INCH, Pattern Name: IQ TREAT BALL 4", Size: 4 INCH, Pattern Name: IQ TREAT BALL 4"
3 Points to consider buying IQ BALL : FUN, SAFETY & COST. IQ BALL out of the well packed box: It is a good toy depending on your dogs' SIZES, TOY DESTRUCTION QUOTIENT & Cost to PlayTime ratio 1) FUN--Great fun for playful dogs who like chasing balls & learning treat rewards for rolling it. 5 Stars FUN & for puppies learning to problem solve. Fun will depend on dog's size, especially if they're mouthy (chew-wise) & how big they open--can the dog get the ball in its mouth to break it? Overall our experience is FUN=5 Stars 2) SAFETY: Our 5 month, 22" high, 30# Australian Pup spent 2 hours of continuous play, first time w IQ Ball. He could not hold or carry it in his small puppy mouth...this is not a problem but a good thing. Larger dogs wont necessary get the pt. if all they do is carry it around. Also---Reckon, any larger dog e.g. Germ. Shep., Rottie., Malamute & esp. Staffordshire Bull, Pit Bull Terriers, or larger mouth dogs could easily crush this lightweight plastic into shattered sharp bits. If the dog is easy going on toys it may be okay. Otherwise I'd worry about it breaking in the dog's mouth. 3) Cost to Time ratio is likely very good if, dog is not too "mouthy" with their toys. Rate it at a 3 overall for Med. to Large Dogs & 5 for pups & smaller dogs. Cost not worth it if dog crushes it in a minute. Our little guy just started playing with IQ Ball again 5 hrs. after unpacking it. At first he chased it around the house for almost 2 hrs. So Cost/Time used ratio depends on your dog's food motivation & love for balls that toss kibble out at various intervals. Set-up's a breeze. Delivery opening is adjustable, depending on kibble size & how much you want to reward the dog. We set delivery hole wide open the first 15 min. Then adjusted it smaller as he figured out, the more I roll this ball, the more treats come out. SAFETY CAN BE AN ISSUE BUT OVERALL, WITH CERTAIN DOGS & DOG SIZE, THIS IQ BALL IS A GOOD 4 STARS. 1 other caveat: uneaten kibble left on floor can be a calling card for little "Mickies" who just LOVE dog kibble. We vacuumed a few times already.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 28, 2015
Y
Verified Purchase
Yahtzee
New York, US
★★★★★ 5
Great for keeping dog busy and for rescues
Size: 3 INCH, Pattern Name: IQ TREAT BALL 3"
We got our dog from a shelter -- we don't know much about her history, but we imagine that she has never been socialized to play with toys because she has no interest in objects whatsoever. We've tried squeaky toys, chew toys, and ropes but to no avail. Other than her Kong (and she only plays with that because she wants the food; she has no interest in the Kong itself), this IQ Treat Ball is the only other toy that she plays with. It took us a day and a couple of meals to teach her how to use it. In fact, we started out by making the toy a bit easier by removing the disk in the center altogether. The disk is still out, but we'll be sure to add it when we feel that she needs the challenge. I LOVE the concept of this toy because it teaches dogs how to play, using food as a motivator, and allows them to really think and problem solve (especially for older rescue dogs who have never really been taught). My dog started out constantly getting the ball stuck under the couch and between furniture, but she now knows how to navigate around the house and how to avoid these "problem areas." She originally had no idea how to push the ball around, but now she noses it around eagerly for her kibble. Aside from that, it is easy to open and easy to clean. I see some negative reviews here, which is unfortunate because even though the toy is made of plastic, it IS well-made. (I should note here that my fiance and I have both dropped the ball from kitchen-counter height to the tile on multiple occasions because we're clumsy, and there are no dents or cracks from the impact.) Even on the packaging, the manufacturer gives you the warning that the ball is NOT for aggressive chewers and should absolutely only be given to a dog under guardian supervision. Giving the IQ Treat Ball to an aggressive chewer, not supervising him, and then blaming the manufacturer for injuries is irresponsible. My dog is not a chewer, and I always watch her while she is playing with this toy, so I think that it's a great product. If you have a rescue/shelter dog who doesn't know how to play with toys, I think this is a fantastic start! I highly recommend! UPDATE (7/15/2014): This toy has lasted a whole month since we started using it mid-June. We use it twice a day for breakfast and dinner, and it's still in good shape. The ridges around the ball do have some minor teeth marks on on them, but that's something that I expected would happen. As far as I'm concerned, it's still in great working order. I am ecstatic with this toy because it has functioned as a segue for our rescue. As I mentioned above, she showed absolutely ZERO interest in toys before. However, we've slowly started getting her out of her anti-toy-socialization shell, and I think this IQ Treat Ball has served a part in that. We've had her for about two months, and in that time we've taught her out to play tug-of-war, how to chase after a ball (Very short distances for now, but hey! Baby steps, right?), and how to chew on ropes and other toys. Now, a lot of hard work has gone into shaping these behaviors on our part, but I really do think that the IQ Treat Ball has improved her appetite, not only for food, but for games as well. My original verdict still stands -- I highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 30, 2014
L
Verified Purchase
Leslie
Pawtucket, US
★★★★★ 5
Fun for your dog and fun for you to watch their antics with this Interactive IQ Treat Ball
Size: 3 INCH, Pattern Name: IQ TREAT BALL 3"
This delightful ball is both a feeding utensil and a workout all in one! Your dog not only eats its calories, it burns them off at the same time! I have a little dachshund, Sophi, who loves her treat ball. They call it a treat ball but I use it for kibble that fits inside. Sophi doesn't need more treats than just a few every few days. If you fill this with treats, it's too much in my opinion, unless you have a really playful dog who needs to gain weight. You place the treats or kibbles inside one half of the ball (the one without the hole in it). Then you adjust the size of the hole in the white center piece to allow either one or a few pieces to fall into the chamber at a time. You place the white flat part over top of the kibbles and then screw on the other half. There is a hole in the end of the ball and once the kibble/treats roll around in the chamber and make their way through the one hole inside to the opposite chamber and then reach that hole, they fall out. Sounds complicated but it's not. This ball teaches the dog that rolling the ball makes treats/kibble fall out and they get to enjoy them. This is where IQ in the name comes in. It doesn't take long for a dog to figure out that they get treats by rolling the ball around and making them fall out. Not only does the dog get exercise pushing the ball around your floor, it really is entertaining to watch. Our Sophi hears the kibbles fall out and if she doesn't immediately see them, because the ball continues to roll, we get to see that "where are they?" and the floppy dachshund ears frantically searching. We have hardwood floors so the ball rolling quickly and bumping into table legs and furniture, Sophi trying to get the kibbles--it's quite a show that has us laughing a lot. It's a sturdy plastic ball, easy to fill and easy to put together. Small enough to tuck into a bag for travel--about the size of a baseball, or smaller. Will roll easy on carpet with a dog pushing it with their nose or very quickly on hardwood. Rather noisy on hardwood floors with the assertiveness of the dog and it bumping into things, so watching something on TV can be difficult. But the entertainment you get, who needs TV? It'll only hold about 1/2 c or a little more of small kibbles (you cannot pack it full) so it's more for multiple feedings, snacking or play. I ordered 2 of these so that when one was used and needed cleaned, there was always a clean one. I throw them in dish water or the dishwasher, top rack with no problem. No cracks or breaks in almost a yr of use. Highly recommend this interactive treat ball. Not only will your dog enjoy it, you will enjoy watching your dog enjoy it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 22, 2015

recommand products