SKU: 19890979744

LOX-1/OLR1 His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 7 - Aug 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LOX-1/OLR1 His Tag Protein, MouseProduct Specification Species Mouse Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR E1 Accession Q9EQ09 Amino Acid Sequence Arg60 Ile363, with N terminal 9*His

Product Specification


Species Mouse
Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR-E1
Accession Q9EQ09
Amino Acid Sequence

Arg60-Ile363, with N-terminal 9*His HHHHHHHHHRQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI

Expression System HEK293
Molecular Weight 45-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Sawamura, T. et al. (1997) Nature 386:73. 

2.Daugherty, A. et al. (2000) Curr. Opin. Cardiovasc. Pulm. Ren. Invest. Drugs. 2:223. 

3.Platt, N. and S. Gordon (2001) J. Clin. Invest. 108:649. 3

4.Platt, N. and S. Gordon (1998) Chem. Biol. 5:R193.

Background

Lectin-like oxidized low-density-lipoprotein receptor-1 (LOX-1), also known as oxidized low-density-lipoprotein receptor-1 (OLR-1), is a type II transmembrane receptor belonging to the C-type lectin family. It also belongs to the functionally defined scavenger receptor (SR) superfamily, whose members share the common ability to bind and internalize modified forms of Low Density Lipoproteins (LDL). LOX-1 is the first member of the class E scavenger receptor subfamily (SR-E). It binds and supports the internalization of multiple structurally unrelated macromolecules including oxidized LDL, advanced glycation end products (AGE), activated platelets, bacteria, apoptotic or aged cells, and heat shock proteins. LOX-1 has also been implicated as an intestinal receptor involved in the transcytosis of pancreatic bile salt-dependent lipase. The human LOX-1 gene encodes a 273 amino acid (aa) residue protein with a short N-terminal intracellular domain, a transmembrane domain, an extracellular stalk/neck region followed by a C-type lectin-like domain (CTLD). The CTLD, which is required for ligand recognition, contains the six conserved cysteine residues present in all C-type lectins, but lacks the Ca2+-binding residues found in classical C-type lectins. LOX-1 can be detected on activated endothelial cells, vascular smooth muscle cells, macrophages, intestinal cells and dendritic cells. The expression of LOX-1 is induced by proinflammatory or proatherogenic stimuli, as well as by oxidized LDL itself and hemodynamic or oxidative stress. Human LOX-1 exists on the cell surface as covalent homodimers, which can further associate into non-covalent-linked oligomers. Cell surface LOX-1 can also be cleaved by yet unidentified proteases to release the soluble LOX-1 extracellular domain. Binding and endocytosis of oxidized LDL by LOX-1 induces oxidative stress, activates NF kappa B, and upregulates the expression of monocyte chemoattractant protein-1 and matrix metalloproteases. LOX-1-dependent oxidized LDL uptake also induces apoptosis by inducing the expression of the pro-apoptotic Bax and downregulation of the anti-apoptotic Bcl-2. Oxidized LDL plays a key role in the pathogenesis of atherosclerosis and endothelial dysfunction. Blockade of LOX-1 functions may turn out to be a suitable target for the therapeutic intervention of atherosclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19890979744

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gina
San Leandro, US
★★★★★ 5
Perfect for small dogs like a Maltese
Color: Pig Balls
My small dogs love them, I have a small poodle and a small Maltese. These balls are a perfect size for their small mouths and have the cutest sound. We have had them almost a month and they haven’t got tore up yet.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
S
Verified Purchase
Sarah A
Omaha, US
★★★★★ 5
Great fun for my small pup
Color: Egg Balls
My 15lb Pom loves anything that sqweeks so these little eggs are perfect for him. They are fun to throw since they bounce in all different directions. Considering how many you get it's worth purchasing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026
C
Verified Purchase
Casandra L.
Cuba, US
★★★★★ 5
dogs have fun with them
Color: Smile Face Balls
They are a cute product. Do not give to large dogs. Made for tiny breeds. I dog sit and the dogs who are allowed to play with them go nuts when I get them out and give a sqeeze. The toys are holding up well too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
J
Verified Purchase
J_B_Cran
Chelsea, US
★★★★★ 5
Love.
Color: Pig Balls
My frenchies love these and large enough not to worry about choking. Also the squeaker lasts longer than most of their latex toys so good or bad, I think it’s good.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
V
Verified Purchase
vvickib54
Los Angeles, US
★★★★★ 5
Puppy Favorite!
Color: Funny Face Balls
Just the right size for a cocker puppy to fit in her mouth (3 mos. old) and squeak. She will do this indefinitely if I let her, lol! Seems to be very satisfying for her. I can only take so much of it but she loves them. Also bounces erratically when you toss it which she loves.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 25, 2025

recommand products