SKU: 85343256112

LILRB2/CD85d/ILT4 His Tag Protein, Human

Sale price$201.60 Regular price$224.00
Save 10%

Pay in installments of $56.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB2/CD85d/ILT4 His Tag Protein, HumanProduct Specification Species Human Synonyms Leukocyte immunoglobulin (Ig) like receptor B2 Accession AAH36827. 1 Amino Acid Sequence Gly24 His458, with C terminal 8*His

Product Specification


Species Human
Synonyms Leukocyte immunoglobulin (Ig)-like receptor B2
Accession AAH36827.1
Amino Acid Sequence

Gly24-His458, with C-terminal 8*His GTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHHHHHHHHH

Expression System HEK293
Molecular Weight

70-80kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin (Ig)-like receptor B2 (LILRB2) is a member of leukocyte Ig-like receptors (LILRs), also known as CD85D, ILT4, LIR2, and MIR10, contains four extracellular immunoglobulin domains, a transmembrane domain, and three cytoplasmic ITIMs. It is expressed on hematopoietic stem cells, monocytes, macrophages, DCs, neutrophils, basophils, platelets, and activated CD4+T cells, as well as in vitro cultured endothelial cells, mast cell progenitors, and osteoclasts. LILRB2 plays physiological roles in multiple tissues. LILRB2 is involved in immunotolerance in pregnancy and transplantation. HLA-G/LILRB2 interactions promote accumulation and the suppressive activity of MDSCs during human pregnancies. Crosslinking of LILRB2 with Fcγ R in vitro led to inhibition of Fcγ R-mediated signaling in monocytes and serotonin release in basophilic cells. Upregulation of LILRB2 induced the tolerance of DCs. Interaction of LILRB2 with HLA class I molecules is positively associated with viral replication in HIV, suggesting that this interaction leads to a blunted immune response. Upregulation of LILRB2 and LILRB4 in antigen-presenting cells in response to Salmonella infection suggests a role for these receptors in balancing the inflammatory response against bacterial infection. LILRB2 is localized in neutrophil lipid rafts and rapidly moves to the cell surface upon neutrophil stimulation. This upregulated LILRB2 then enhances the inhibitory signals of HLAG on the phagocytic function of neutrophils. Future studies are required to shed light on how neutrophil and immune responses are modulated through LILRB2 interactions with this diverse set of ligands.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 85343256112

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jimmy
Phoenix, US
★★★★★ 5
Best Sublimation Paper
Size: 8.5"x11"
I’ve been using A-Sub paper for my sublimation projects, and it is easily one of the best. The ink dries almost instantly once printed, so I don’t have to worry about smudging the design or getting those annoying "pizza wheel" marks from the printer rollers. The paper itself feels substantial and doesn't tear or curl easily. One of the biggest wins for me is that it never jams; it feeds through perfectly every time, saving me the frustration of wasting expensive ink and paper. When I go to press my designs, the ink releases almost completely, leaving very little behind on the paper and putting all that color onto the project. The final results look super professional, with colors that are vibrant and sharp rather than looking faded or dull. It has worked perfectly for everything I’ve tried so far, and if you want a reliable paper that gives you consistent, high-quality results, this is definitely the one to get.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
N
Verified Purchase
Nadiagne
Battle Creek, US
★★★★★ 5
Ideal for sublimation beginners.
Size: 8.5"x11"
Asub sublimation paper has been excellent for my projects. The ink transfer is very good, the colors are vibrant and defined, and it dries quickly. It has helped me achieve clean and professional results, even as a beginner. Without a doubt, it's a reliable, high-quality paper for sublimation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
C
Verified Purchase
Chiller Leonard
Alexandria, US
★★★★★ 5
Excellent works great and I’m bang for your buck
Size: 8.5"x14"
I love this paper. It prints, nice and clear I will be buying more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
F
Verified Purchase
Fe Oyekola
Phoenix, US
★★★★★ 5
Very good for sublimation
Size: 8.5"x11"
Intact and very good for my sublimation
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
T
Verified Purchase
Tasha
Phoenix, US
★★★★★ 5
Great paper and beginner friendly
Size: 8.5"x11"
I Really like using this A-Sub paper
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026

recommand products