SKU: 199256381

Human CD81, His Tag

Sale price$119.25 Regular price$132.50
Save 10%

Pay in installments of $33.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 4 - Aug 9

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD81, His TagProduct Specification Species Human Synonyms 26 kDa cell surface protein TAPA 1, Target of the antiproliferative antibody 1, Tetraspanin 28 (Tspan 28) Accession P60033 Amino Acid Sequence Protein sequence(P60033, Phe113 Lys201, with C 10*His) FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 4kDa Actual: 11kDa Purity 95% by SDS PAGE

Product Specification


Species Human
Synonyms 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, Tetraspanin-28 (Tspan-28)
Accession P60033
Amino Acid Sequence

Protein sequence(P60033, Phe113-Lys201, with C-10*His)


FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 11.4kDa Actual:11kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70℃ as supplied.

1 month, 2 to 8℃ under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

CD81 is a member of the transmembrane 4 superfamily and it is a cell surface glycoprotein that is known to complex with integrins. CD81 appears to promote muscle cell fusion and support myotube maintenance. Also it may be involved in signal transduction. Moreover, CD81 plays a critical role in Hepatitis C attachment and cell entry by interacting with virus' E1/E2 glycoproteins heterodimer. The large extracellular loop of CD81 binds the hepatitis E2 glycoprotein dimer. It also appears to play a role in liver invasion by Plasmodium species.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 199256381

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LaChante Anderson
Omaha, US
★★★★★ 5
Good plot but definitely slow burn
Format: Kindle
⭐️⭐️⭐️⭐️.5|🌶️🌶️🌶️🌶️ (not a ton of spice scenes for an Omegaverse) The plot, character development, scene progression, and action throughout the story was done really well. I did wish there was better pacing for the spice. I felt like the big spice was really rushed. During some scenes the story was a little hard to follow. I think some parts could’ve been cut. Overall I would read more from this author! 💖
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2025
A
Verified Purchase
Amazon Customer
Port Orchard, US
★★★★★ 5
omg loved the story
Format: Kindle
I’ve been in a reading slump DNFing so many books and finally found a story to keep me captivated… now with that though there were still some parts that were a bit of a struggle like Tatums struggle with the past trauma she dragged that on for ever I get it pasts are hard to overcome sometimes. But honestly it was easy to get over it falling in love with all these little psychos 🤣🤣🤣 absolutely loved Kodi’s obsession with getting Easton even though he doesn’t know him but smells brownies everywhere and missing the mark it was hysterical.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2025
L
Verified Purchase
Lisa Maddison
Lowell, US
★★★★★ 4
Omegaverse with rival families.
Format: Kindle
Tatum is trying to raise enough money to treat her omega mother who has fallen catatonic due to the death of her mate. To make the money she needs she agrees to work at a gentleman's club scantily dressed. There she meets the twin Hayes brothers, Declan and Kodiak, what she doesn't know is that their younger half brother is the high school sweetheart that ghosted her after helping with her first heat. Tatum also meets Easton, the mysterious male omega that pops into her life but she finds herself strongly attracted to. I enjoyed all the characters, even those that were not major characters, the plot was good, the storyline was well done. I would recommend this book if you liked Omegaverse stories, mafia storylines, and good romance with why choose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2025
T
Verified Purchase
T_Mich13
Massapequa, US
★★★★★ 5
Loved it!
Format: Kindle
Who doesn’t love morally grey men obsessed with their omega who isn’t afraid to call them out on their unacceptable behavior and make them grovel? Tatum really is a survivor through and through. She is willing to do anything to get her mother the help she needs, even deal with the man her broke her heart. If you love brothers playing jokes, crazy stabby omegas and rich men being told no, you will enjoy this book. Great spice and great ending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 5, 2025
S
Verified Purchase
Sycokittykat - Steff
Battle Creek, US
★★★★★ 4
Omega survival mode
Format: Kindle
Tatum is an Omega who has been suppressing herself since she had a heartbreaking fallout after her first heat. The boy she loved ghosted her after it was over.  Tatum lost her father when she was just 8 and her mother struggled to survive until Tatum got to be an adult and was unable to keep pushing. So now Tatum is being the parent and she needs a better paying job so she can afford to put her mother in a care facility until she is better. When she finds a job posting for Haze Instincts she knows they take care of their Omega staff and if she is a dancer or maybe something more she will be able to catch up on bills and get her mom taken care of.  As she is exposed to a few different irresistible Alphas she is forced to remember who she is and face everything she has been running from. Will she be able to accept all of her Omega nature, get her mother the care she needs, form a pack and let go of the past? This book was sad and sweet too. Tatum has been through so much and she doesn't know how everything fits together. As the pieces fit into the puzzle she has to choose a future even if it is scary.  I love the ladies she works with at the club. Their personalities are so fun. Also, I love a groveling Alpha. Though Mr. Brownies was a fun twist. I love that the story was comprehensive and filled in all of the missing pieces in a way that was engaging and made sense.  That epilogue was so freaking sweet and an absolutely perfect ending.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2025

recommand products