Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 16 - Aug 21
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human CD9 , His tagProduct Specification Species Human Synonyms 5H9 antigen, Cell growth inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility related protein (MRP 1), Tetraspanin 29 (Tspan 29), p24, MIC3, TSPAN29 Accession P21926 Amino Acid Sequence Protein sequence(P21926, Ser112 Ile195, with C 10*His) SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11.
Product Specification
| Species | Human |
| Synonyms | 5H9 antigen, Cell growth-inhibiting gene 2 protein, Leukocyte antigen MIC3, Motility-related protein (MRP-1), Tetraspanin-29 (Tspan-29), p24, MIC3, TSPAN29 |
| Accession | P21926 |
| Amino Acid Sequence | Protein sequence(P21926, Ser112-Ile195, with C-10*His) SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Theoretical:11.3kDa Actual:10kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD9 is a cell surface glycoprotein that consists of four transmembrane regions and has two extracellular loops that contain disulfide bonds which are conserved throughout the tetraspanin family. Also containing distinct palmitoylation sites that allows CD9 to interact with lipids and other proteins. CD9 is commonly used as a marker for exosomes as it is contained on their surface. CD9 has a diverse role in cellular processes as it has also been shown to trigger platelet activation and aggregation. CD9 can also modulate cell adhesion[24] and migration.[25][26] This function makes CD9 of interest when studying cancer and cancer metastasis. However, it seems CD9 has a varying role in different types of cancers. Studies showed that CD9 expression levels have an inverse correlation to metastatic potential or patient survival.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.7 ★★★★★
Based on 9 reviews
Sort
Product Reviews
★★★★★ 5
Beautiful collectible FIFA puzzle
Color: Trophy 3, Size: 200Pcs, Color: Trophy 3, Size: 200Pcs
This a 200 piece puzzle. It is a very well made laser cut wooden puzzle licensed by FIFA. It depicts the FIFA trophy. I like that the pieces are really solid and made of wood, about 3/16 of an inch thick (5mm). They are very durable and there is no puzzle dust. The puzzle is about 9x13 inches when finished, a perfect size for wall display. The colors are bright and the piece shapes are really out of this world. The back of the puzzle has some related designs imprinted. It is shipped in a brown box with the gift puzzle box inside the plain box, so it makes a nice gift. Included is a draw-string bag for piece storage and a laminating style sticky sheet to secure the puzzle for hanging. It looks good and will make a nice practical game room collectible. This is a nice value for a puzzle collectible display piece.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
★★★★★ 5
Beautiful, well made puzzle
Color: Trophy 3, Size: 200Pcs, Color: Trophy 3, Size: 200Pcs
I am a big jigsaw puzzle enthusiast. It's the norm for there to be a 1000 piece puzzle on my dining room table at any given moment. This is my first experience with a wooden puzzle and I have to say I think I am hooked. This is a small, 200 piece puzzle, but it was so much fun!
What I loved -
*Let's just start with how pretty and vibrant this puzzle is! The colors are bright and it's print is sharp.
*The pieces are beautifully laser cut and finished. No rough edges or burrs.
*There are several specialty pieces, most are soccer related. What a great touch!
*The pieces fit beautifully.
*It comes with a pull string bag for storage and the items necessary to preserve and hang once completed.
I am a fan and plan to order more of these fun puzzles!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
★★★★★ 5
Very good!
T-Shirt is very nice and very comfortable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
★★★★★ 5
FIFA World Cup mascots t shirt - very cute!
The t shirt is very nice. I was looking for 2xl but because they didn't have I purchased 3xl. Not a huge difference between the sizes and a wash will probably solve the problem.
My husband liked it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
★★★★★ 5
T shirt is great quality!
Great T shirt! The quality of the material is quite nice. It’s more than I’d normally pay for a T shirt. However, for a “special “ event T, much less than you’d pay at the event! I bought another after seeing the first one.
Father and son, 2026 soccer revolution, off and away :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
recommand products
Dermistry Natural Mineral Sunscreen for Sensitive Skin & Children SPF 50 UVA UVB PA+++ Protection
11.01
Pentacare Ayurveda Pippali Churna
11.76
Dermistry Sensitive & Dry Skin Care Calming Soothing Body Milk Lotion Shea Butter & Vitamin E
16.52
Atrimed Plant Science Anti Acne Cream
12.72
Vaseline Men Fast Absorbing Body and Face Lotion
47.35