SKU: 2141376090

Human CSF1R, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CSF1R, His tagProduct Specification Species Human Synonyms CSF 1 receptor (CSF 1 R; CSF 1R; M CSF R), Proto oncogene c Fms, CD115, FMS Accession P07333 Amino Acid Sequence Protein sequence(P07333, Ile20 Asn320, with C 10*His)

Product Specification


Species Human
Synonyms CSF-1 receptor (CSF-1-R; CSF-1R; M-CSF-R), Proto-oncogene c-Fms, CD115, FMS
Accession P07333
Amino Acid Sequence Protein sequence(P07333, Ile20-Asn320, with C-10*His) IPVIEPSVPELVVKPGATVTLRCVGNGSVEWDGPPSPHWTLYSDGSSSILSTNNATFQNTGTYRCTEPGDPLGGSAAIHLYVKDPARPWNVLAQEVVVFEDQDALLPCLLTDPVLEAGVSLVRVRGRPLMRHTNYSFSPWHGFTIHRAKFIQSQDYQCSALMGGRKVMSISIRLKVQKVIPGPPALTLVPAELVRIRGEAAQIVCSASSVDVNFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:34.6kDa Actual:50kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Colony stimulating factor 1 receptor (CSF1R), also known as macrophage colony-stimulating factor receptor (M-CSFR), and CD115 (Cluster of Differentiation 115), is a cell-surface protein encoded by the human CSF1R gene (known also as c-FMS). CSF1R is a receptor that can be activated by two ligands: colony stimulating factor 1 (CSF-1) and interleukin-34 (IL-34). CSF1R is highly expressed in myeloid cells, and CSF1R signaling is necessary for the survival, proliferation, and differentiation of many myeloid cell types in vivo and in vitro. CSF1R signaling is involved in many diseases and is targeted in therapies for cancer, neurodegeneration, and inflammatory bone diseases.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 2141376090

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
AMM
Natrona Heights, US
★★★★★ 5
Fun and durable
Color: Flag, Size: 6 Inch, Color: Flag, Size: 6 Inch
I have a 5 month old teething Whippet puppy and this toy is a favorite. She loves carrying it around by the straps, playing tug, and trying to chew it. I think it’s pretty tough and durable for someone her size. I could see how a shepherd might destroy it quickly, though. I was surprised to find you have to inflate it, but the pump and needles are included and it hasn’t lost any air over several days of rough play. (I kick it and toss it to her. We tug with the straps. She carries it everywhere.) The material feels like a heavy duty soccer ball, just smaller. It’s the perfect size for her. I’d definitely buy it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
L
Verified Purchase
Leo
Omaha, US
★★★★★ 4
It's a (smaller) soccer ball with nylon straps. Will no last long for aggressive chewers.
Color: Black Green, Size: 8 Inch
As the item title states, it's a soccer ball with straps. It feels like a soccer ball, but smaller and doesn't make any noises. The 8 inch size just right for my 50 lb dog. He can't get his mouth around the ball, but can bite down on the straps as we kick it around. He also plays and tosses it around by himself. It's also easy to clean. It's a good item, but suffers from two issues. 01) The nylon straps are tough, but not as durable as I though. My dog is aggressive chewer and has managed to chew them up a bit. 02) There is a nylon strap that is longer than all the others, so he tends to focus on that one. After about 15 days of playing with hit, he's managed to chew that strap up to the point that it's almost falling off. It would be nice if all the straps were the same, larger, size.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 27, 2025
D
Verified Purchase
debra
Boise, US
★★★★★ 5
Highly recommend
Color: Black Green, Size: 8 Inch
I was skeptical that it would hold up to our aggressive chewer puppy (staffyX) - especially during teething. But it has survived past teething into adult chompers and is still fantastic! Its his favorite outside toy, especially the tags make it fun (and those have been holding up well too). If/when it fails, I'll buy another one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
A
Verified Purchase
Amazon Customer
Massapequa, US
★★★★★ 3
great design, poor overall quality
Color: Black Green, Size: 8 Inch
My dog loves these balls. The "tags" are a great design. The problem I have is the quality as they aren't tough enough. He goes through them pretty quickly tearing off the tags and puncturing the ball. He doesn't get that these actually cost money! Each one also comes with a small pump, which I guess is great for a one time buy?, but man, if you don't own a pump just buy one and keep one. I have no use for several of these cheap pumps. How about offering the pump as an add-on for a dollar or two?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
A
Verified Purchase
Amazon Customer
Birmingham, US
★★★★★ 5
Ummmm🙄 not indestructible!
Color: Yellow Green, Size: 6 Inch, Color: Yellow Green, Size: 6 Inch
I have a Aussie doodle ( 1 1/2 yr old) so I decided to get her this one for Christmas and she loved it (she plays soccer with my grandkids-so I thought it would be a perfect gift and the colors are so cool green and yellow) however ..if your dog is like mine, she busted it within two days first tried chewing off the handles so I decided to cut the rest of them off-then proceeded to tear one of the pentagons entirely off and finally completely busted it… which made her very happy, but I was very sad!! If your dog is not a chewer and does not stop until she tears it apart, especially if it has some kind of noise maker which this does not-it’s a great ball and really well made! She loved it from the minute she got it played with it-wouldn’t let us take it away from her! It is made and looks like a real soccer ball. So I will have to keep searching for an indestructible soccer ball🙄😁
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026

recommand products