SKU: 21951038540

Human PTH , His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PTH , His tagProduct Specification Species Human Synonyms Parathormone, Parathyrin Accession P01270 Amino Acid Sequence Protein sequence(P01270, Ser32 Gln115, with C 10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 11. 1kDa Actual: 10, 12kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms Parathormone, Parathyrin
Accession P01270
Amino Acid Sequence

Protein sequence(P01270, Ser32-Gln115, with C-10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Theoretical:11.1kDa Actual:10, 12kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Parathyroid hormone (PTH), also called parathormone or parathyrin, is a peptide hormone secreted by the parathyroid glands that regulates the serum calcium concentration through its effects on bone, kidney, and intestine. PTH influences bone remodeling, which is an ongoing process in which bone tissue is alternately resorbed and rebuilt over time. PTH is secreted in response to low blood serum calcium (Ca2+) levels. PTH indirectly stimulates osteoclast activity within the bone matrix (osteon), in an effort to release more ionic calcium (Ca2+) into the blood to elevate a low serum calcium level. Disorders that yield too little or too much PTH, such as hypoparathyroidism, hyperparathyroidism, and paraneoplastic syndromes can cause bone disease, hypocalcemia, and hypercalcemia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 21951038540

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michael Campbell
Battle Creek, US
★★★★★ 5
Chew King Supreme Chew Toy
Color: B) Medium 3" Ball
So far, freaking amazing. This ball is awesome. I have a 90 lb American Bulldog. Like other reviews. Lot of " indestructible balls" lasted minimum time. Not this one. She even took it to bed with her I bought the 3 inch ball, not the 4 inch ball. The 3 inch ball works amazingly for a large Dog. Yes the 4 inch would be better. So in my opinion, either ball would be fine. As others also said. This ball keeps a active Dog busy for hours. Love to play catch. Love frozen peanut butter in it. One last thing. The price is amazing. I don't see needing to buy another, unless it is lost, because this is made to last. We couldn't be happier.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2026
K
Verified Purchase
Kelsey
Los Angeles, US
★★★★★ 5
Malinois proof
Color: B) Medium 3" Ball
So far this has held up great. My Malinois who has destroyed nearly every ball I’ve gotten her, this one has lasted over 3 weeks without a dent, compared to some that don’t even last a day lol. Although the medium size is a little too big for her liking she still plays with it. It’s very durable and I like the middle part for engagement as well. I would recommend if you have a dog who destroys every ball possible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
T
Verified Purchase
TERRIE GILLAND
Draper, US
★★★★★ 5
Actually Durable
Color: B) Medium 3" Ball
One of the few "heavy duty" toys that my pittie hasn't destroyed after a couple of weeks. Most of them last two days. She's an absolute beast so I'm confident if she can't destroy it, few dogs can.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
C
Verified Purchase
Cody
Belleville, US
★★★★★ 1
Not for aggressive chewers!
Color: H) Infinity Ring, Color: H) Infinity Ring
Not for aggressive chewers! Done for in about two minutes. I unboxed this and tugged with my Mal for a but then let her have it. Within minutes she had chewed through it. Not worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
N
Verified Purchase
Nicole Lomonaco
Alexandria, US
★★★★★ 4
Dog ball
Color: A) Small 2.5" Ball
My dog enjoys but smaller than expected
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026

recommand products