SKU: 22810674892

Biotinylated BCMA His&Avi Tag Protein, Human

Sale price$230.40 Regular price$256.00
Save 10%

Pay in installments of $64.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated BCMA His&Avi Tag Protein, HumanProduct Specification Species Human Antigen BCMA Synonyms TNFRSF17, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Met1 Ala54, with C terminal His&Avi Tag MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAGGGSHHHHHHHHGLNDIFEAQKIEWHE Expression System HEK293 Molecular Weight 15 17kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Biotin Tag Avi Tag, His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Human
Antigen BCMA
Synonyms TNFRSF17, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Met1-Ala54, with C-terminal His&Avi Tag MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAGGGSHHHHHHHHGLNDIFEAQKIEWHE

Expression System HEK293
Molecular Weight

15-17kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Nina Shah, Ajai Chari, Emma Scott, Khalid Mezzi & Saad Z. Usmani: B-cell maturation antigen (BCMA) in multiple myeloma: rationale for targeting and current therapeutic approaches, Leukemia volume 34, pages985-1005 (2020).

Background

BCMA (The B-cell maturation antigen), also designated as TNFRSF17, belongs to the tumor necrosis factor receptor superfamily, which is a family of cytokine receptors. BCMA is encoded by a 2.92-kb TNFRSF17 gene located on the short arm of chromosome 16 (16p13.13) and composed of 3 exons separated by 2 introns. There are four natural splice variants of human BCMA that present with different receptor binding affinities, membrane-anchoring ability, and intracellular domain signaling. BCMA main ligands are the cytokines B-cell activating factor and a proliferation-inducing ligand. The interaction between BCMA and its ligands activates the NF-κB signaling pathway that plays an important role in B-cell proliferation and maturation and is essential for the survival of long-lived bone marrow plasma cells. BCMA is expressed preferentially on mature B cells and has minimal expression on hematopoietic stem cells or other cell types. The BCMA has emerged as a central target in multiple myeloma (MM). In preclinical studies, overexpression of BCMA and the interaction with is ligand, a proliferation-inducing ligand (APRIL), was found to promote MM progression in vivo and augment MM cell growth and survival through induction of multiple signaling cascades, including protein kinase B (AKT), MAPK, and nuclear factor (NF)-κB. Additionally, BCMA has been shown to be solubilized at high levels in serum of patients with MM (sBCMA). This form of sBCMA binds to B-cell activating factor (BAFF). The role of BAFF is to stimulate normal B-cell and plasma cell development; however, this functioning is prevented when it is bound by BCMA in the serum, thereby leading to decreased polyclonal immunoglobulin levels in patients with MM.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 22810674892

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
F
Verified Purchase
Fadi
Houston, US
★★★★★ 5
Worth every penny
Color: Black
Amazing product. Looks sleek on my desk and very minimal design I love. Two retractable usbc cables and additional ports on the side are nice. They thought this product through. Worth the price great value for money spent.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
B
Verified Purchase
Beth
Houston, US
★★★★★ 5
Great option for a great price
Size: 7.5, Color: Black
I love these sandals. They are well made, true to size and soft suede. They are lightweight and feel just like my UGG goldenstar sandals. (These are not as adjustable, so if you have narrow or wide feet, these may not be for you) These a great value for the money, especially for medium width feet. The strap across the toe is not adjustable, but fit my feet just fine. The ankle strap was a good length for me. And the Velcro is strong. These sandals are a great value for the money. I will probably start looking into kookaburra before I rush to buy the more expensive ones now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
N
Verified Purchase
Never received!! Very disappointed!!
Port Orchard, US
★★★★★ 5
Quality, good looking shoes!
Size: 8.5, Color: Green
Absolutely perfect fit, design, and color. I'm so pleased with these sandals and as always with this brand, I am not in anyway disappointed. These shoes are so comfortable right out of the box. They clean up very nicely, and last forever. I am so glad I got these before they were sold out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
M
Verified Purchase
Marla
Carnegie, US
★★★★★ 5
UGG Comfort Without the Premium Price
Size: 9, Color: Beige, Size: 9, Color: Beige
These sandals are super cute and incredibly comfortable. They have that classic UGG look and feel, but at a much more approachable price point. The footbed is cushioned and supportive, making them easy to wear for extended periods. The straps feel secure without rubbing, and the overall construction feels solid and well made. They’re lightweight but still have a sturdy sole with good traction. They pair effortlessly with casual outfits and have that relaxed, elevated vibe UGG is known for—just without the higher price tag. A great value for both style and comfort.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2026
D
Verified Purchase
Diane
San Leandro, US
★★★★★ 5
Ugg comfy shoes
Size: 7, Color: Black
So comfortable and cute as well. I wore these the first time and had to have everyone touch them to see how the sole would squish. Fit well, and are lightweight as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026

recommand products