SKU: 23175722919

BMPRIA/ALK-3 Fc Chimera Protein, Mouse

Sale price$212.40 Regular price$236.00
Save 10%

Pay in installments of $59.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

BMPRIA/ALK-3 Fc Chimera Protein, MouseProduct Specification Species Mouse Antigen ALK 3 BMPRIA Synonyms 10q23del; ACVRLK3; ALK3 Accession P36895 Amino Acid Sequence Gln24 Arg152, with C terminal Mouse IgG Fc

Product Specification


Species Mouse
Antigen ALK-3/BMPRIA
Synonyms 10q23del; ACVRLK3; ALK3
Accession P36895
Amino Acid Sequence

Gln24-Arg152, with C-terminal Mouse IgG Fc QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 45-53kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Proc Natl Acad Sci U S A. 2002 Mar 5;99(5):2878-83. Epub 2002 Feb 19.

Background

Activin receptor-Like Kinase 3 (ALK-3), also known as Bone Morphogenetic Protein Receptor, type IA (BMPR1A), is a type I receptor for bone morphogenetic proteins (BMPs) which belong to the transforming growth factor beta (TGF-β) superfamily. The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A (this protein) and BMPR1B and the type II receptor BMPR2. ALK-3 plays an essential role in the formation of embryonic ventral abdominal wall, and abrogation of BMP signaling activity due to gene mutations in its signaling components could be one of the underlying causes of omphalocele at birth.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23175722919

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
It's cool.
New York, US
★★★★★ 4
Weightless, well made. But there are problems with size
Size: 8.5, Color: White
I bought it for a teenager, for size 81/2. This, according to the dimensions on the page, is 25.9 centimeters. They came, the size was indicated correctly, but they are large for the child. Very large. They fit me, size 10. The child is disappointed. Well made, look neat on the foot. Almost weightless But I can't give the maximum rating. I wish the seller to deal with the size grid.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
M
Verified Purchase
Matthew Gonzales
Phoenix, US
★★★★★ 5
Amazing Shoe!
Size: 9 Wide, Color: Blazer Blue Hand Stain
Amazing shoe!! Comfortable to wear for long periods of time! Highly recommend!! 👍🏾
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 17, 2025
W
Verified Purchase
William Mantilla
West Palm Beach, US
★★★★★ 5
Calzado elegante para oficina de excelente calidad
Producto de excelente calidad. La entrega fue rápida y el empaque llegó en perfectas condiciones. Cumple completamente con lo descrito en la publicación.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
M
Verified Purchase
MH
Los Angeles, US
★★★★★ 3
Not A Walking Shoe
Size: 9.5, Color: Black/British Tan
In the photo online this shoe looks like it will be very comfortable. Kind of a classy Coach's Shoe. Also in the photo the heel portion of the sole looks thick and supportive. I bought them thinking they would be my go-to travel shoe. Wrong. This is not a comfortable shoe for extended wear. Short durations, OK. The main problem is that the sole is very thin and flexible in all directions. There is no, as in zero arch support, plus that thin heel means that you tend to rock back on your heels and it feels like you're pounding the pavement. I've worn once and I'm very disappointed. They look great, definitely high quality materials, but using them for the intended purpose of travel.... fah get about it. If you're looking for a good looking shoe to wear around the gym and you don't intend to use the treadmill, or elliptical, then this is the shoe you want. They would definitely be returned if I hadn't already worn them outside.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 11, 2023
D
Verified Purchase
DF
Louisville, US
★★★★★ 5
Great shoe!
Size: 14 Wide, Color: Woodbury Handstain
Great shoe- better leather cover than last pair that scuffed if you blinked at them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026

recommand products