SKU: 57504248879

CD200R His Tag Protein, Mouse

$271.80 $302.00
Save 10%
No.2 Bestseller on watersyst.com >

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 24 - Jul 29

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD200R His Tag Protein, MouseProduct Specification Species Mouse Antigen CD200R Synonyms Cell surface glycoprotein OX2 receptor 1CD200 cell surface glycoprotein receptor Accession Q9ES57 Amino Acid Sequence Thr26 Pro238, with C terminal 8*His TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRPGGGSHHHHHHHH Expression

Product Specification


Species Mouse
Antigen CD200R
Synonyms Cell surface glycoprotein OX2 receptor 1，CD200 cell surface glycoprotein receptor
Accession Q9ES57
Amino Acid Sequence

Thr26-Pro238, with C-terminal 8*His TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRPGGGSHHHHHHHH
Expression System HEK293
Molecular Weight

40-70kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Rosenblum, M.D. et al. (2006) J. Dermatol. Sci. 41:165.2. Gorczynski, R.M. (2005) Curr. Opin. Invest. Drugs 6:483. 3. Barclay, A.N. et al. (2002) Trends Immunol. 23:285.

Background

CD200 R1, also known as OX-2 receptor, is a 90 kDa, type I transmembrane protein that belongs to the immunoglobulin superfamily. CD200 R1 is important in the regulation of myeloid cell activity.CD200 and its receptor CD200R are both type-1 membrane glycoproteins, which are members of the immunoglobulin superfamily (IgSF). Besides the inhibitory effect on macrophages, CD200/CD200R also play an important role in regulating the regulatory T cells, allergic reaction, autoimmune diseases, allograft, neurological diseases and other autoimmune-related diseases. The interaction between CD200, which is mainly present in neurons but also in astrocytes, and CD200R1, which is mainly present in microglia, is one of the mechanisms involved in keeping the microglial proinflammatory phenotype under control in physiological conditions. Limits inflammation by inhibiting the expression of pro-inflammatory molecules including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to selected stimuli.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57504248879

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
P Scott
Bozeman, US
★★★★★ 5
Cooling and comfortable pillow cover
Color: White, Size: Queen
This is a very nice pillow cover. It’s very well made, has a zipper and the fabric is what I consider as plush. It’s very pretty but I use it under the pillow case. The best feature to me is that it keeps my head cool. I sleep on a latex pillow and they are usually too warm for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
E
Verified Purchase
Egle Patamsyte
Whiting, US
★★★★★ 5
Pillow case
Color: White, Size: Body
Here is another example of a review about a pillow case that matches your description: I ordered this pillowcase because I needed a pillow case on my special body pillow-that was long, cozy, and soft. I was not disappointed. These pillow case are made from 100% organic bamboo viscose, which is hypoallergenic, breathable, and silky smooth. They have a special shape that fits my extra-long pillow perfectly, and it doesn’t slip off or bunch up. This is also very easy to care for, as it is machine washable and wrinkle resistant. I like chose the white one because it looks elegant and fresh. This pillowcase definitely worth the price, and I would recommend it to anyone who wants a high-quality pillow case that is long, cozy, and soft.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2023
N
Verified Purchase
Neal
New York, US
★★★★★ 5
Wonderful pillow and products!
Color: White, Size: Body
I've been using the Snuggle-Pedic pillow for a couple of weeks now, and it is fantastic. It's soft, but the foam is firm and full. It is clearly extremely well made. Everything from Snuggle-Pedic appears to be top quality, right down to the extra little instructional inserts they include with their products. I also purchased the Zipper Removable Cover to make laundering easier. It's just as well made as the pillow. In fact, it's exactly the same as the cover on the pillow except removable due to the zipper. I'm also using the Snuggle-Pedic Organic Cotton Pillow Case, and it too is extremely well made, soft and comfortable. I was a little hesitant about the pillow case when I saw the picture because it almost looked ... too soft for me, sort of like a fleece blanket. Maybe that was just the way I saw the picture, but it's not actually like fleece. It's very soft and comfortable and does stretch a little as opposed to a regular pillow case, as they say in the description, but in a good way and appears very durable. I was concerned that it would stretch out and twist around the pillow, but it doesn't do that at all. It has stayed perfectly fitted to the pillow. From what I've experienced, everything in the descriptions of the Snuggle-Pedic products is true, and all three pieces work perfectly for me. This is the most I've spent on an individual pillow, but I couldn't be more pleased, and I'm planning to replace all my pillows.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 16, 2016
D
Verified Purchase
Derek
Alexandria, US
★★★★★ 4
Cool Slumberings
Color: White, Size: Queen
For transparency, I was given this pillowcase to review by Relief Mart. However all views are my own and not biased because of it. I had recently purchased the matching pillow (see my other review) and had the opportunity to try this out. In terms of specs, it's basically made out of the same material as the Snuggle-Pedic Bamboo Shredded Memory Foam Pillow - it even has the same woven design. According to manufacturer claims: 'Soft and Luxurious Kool-Flow® Micro-Vented Bamboo Cover' - The pillowcase material is very soft to the touch, and does have a premium feel to it. It did have a slight 'smell' when it first arrived, however once washed (and air dried) it's not there anymore. 'Unprecedented breathability that allows air to circulate through the pillow' - It definitely keeps a certain 'coolness' and doesn't heat up if you stay in one spot. It makes staying still bearable, as I'm a sleeper always looking for the cooler side of the pillow during the night. As described, it's zippable so you can separately wash it from the pillow, and I can attest that it does keep it's softness and fluffliness after 3 weeks of use. Though I'm very happy with it, there's a couple things to build on in my opinion: - color and texture of fabric. By itself, the look of the pillow makes it seem that there's no pillowcase. So if you're picky about your bedsheets when you make your bed, this pillowcase will probably stick out like a sore thumb. The unsubtle branding and slight off white coloring doesn't help as well. - there's a tag outside the pillowcase near the zipper, and though it doesn't affect it in any way, it can be slightly annoying and aesthetically displeasing as it sticks out a bit. Would suggest placing it on the inside. I would definitely recommend this product, irrespective of the (minor) points above, as this has made my slumbering experience a whole lot better.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 16, 2016
M
Verified Purchase
M.H.
Natrona Heights, US
★★★★★ 5
Great pillow case from a company that cares!
Color: White, Size: Body
The Snuggle-Pedic Body Pillow Case is GREAT and is the perfect pillow case for their body pillow! Feels exactly like the great material that's on the body pillow (soft and breathable) -- and it fits the pillow perfectly! I love that there's a zipper on it as I don't have to deal with the pillow slipping out of the case at all. The case fits perfectly and is the perfect case for the pillow! I read some other reviews where people said they didn't love that the tag/label was on the opposite side of the zipper on the case. But for me this was a non-issue. I cut the tag off and now there's no issue at all. :) Oh, and I have to give a shout out to Snuggle-Pedic and their company....they are awesome! They did offer me a free case in exchange for an honest review. But this isn't what I think they are awesome for. I find them to be a stand up company that is truly there to support their customers! They include a little note when you get the pillow and pillow case giving you their phone number and letting them know they are here to help if we have any questions. And they send an email as well saying they are available if we have any questions and they gave suggestions on how to care for their products. They are quick to respond and truly lovely people. I'm a sucker for supporting good companies....companies that actually truly care about their customers...and this company is that! I highly recommend this product :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2016

recommand products

HU 113 - Unveiling Of POW Memorial, Norman Cross, Huntingdonshire c1914
10.95
HU 196 - The Bridge & Chantry Chapel, St Ives, Cambridgeshire
13.00
HU 207 - Cromwell House, Huntingdon, Cambridgeshire c1954
13.00
HU 14 - Waresley Village, Huntingdonshire c1935
10.95
HU 234 - St Neots Railway Station, Cambridgeshire
13.00