SKU: 24868482628

FABP7 His Tag, Human

Sale price$240.75 Regular price$267.50
Save 10%

Pay in installments of $66.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP7 His Tag, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 7 Accession O15540 Amino Acid Sequence Val2 Ala132, with N terminal 8*His MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms Fatty acid binding protein 7
Accession O15540
Amino Acid Sequence Val2-Ala132, with N-terminal 8*His MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid binding protein 7 (FABP7, alternative names brain FABP (B-FABP), brain lipid-binding protein (BLBP) and mammary derived growth inhibitor-related gene (MRG)). Compared to normal brain tissue and low-grade astrocytomas, FABP7 is up-regulated in glioblastoma, and increased nuclear localization of FABP7 in glioblastoma is associated with EGFR amplification and poorer outcomes. The expression of FABP7 is also linked to enhanced cell motility and migration, with a decreasing docosahexaenoic acid (DHA, [ω-3])-arachidonic acid (AA, [ω-6]) ratio appearing to govern these effects, perturbing the normal, tightly regulated ratio of fatty acids in brain tissue and providing increased substrate for prostaglandins such as PGE2 to promote progression.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24868482628

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Debra L Smith
New York, US
★★★★★ 3
Soap for skin irritations
Mild. No irritation to my psoriasis
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 21, 2025
A
Verified Purchase
Anon
Battle Creek, US
★★★★★ 5
Fantastic soap for the dermatitis and eczema prone
You guyyyyysss, my hands have no dry, itchy spots right now. None. This is remarkable because before now I have for years had issues with eczema/contact dermatitis patches that have at times (aka: most times) been pretty unbearable. To say that I’m overjoyed to have found a natural soap that truly works for me is an understatement. When you use this, you can feel that it’s moisturizing your skin. It’s fantastic. If you haven’t tried it, do yourself a favor and get yourself a bar. I’m wondering now if I can use it on my entire body and to wash my hair. That’s probably a little overboard, but it’s that good and now that I’ve used it I suspect all my skin problems are contact dermatitis that could be solved by the right soap/shampoo.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 30, 2022
T
Verified Purchase
Tiffany
Los Angeles, US
★★★★★ 5
It works
It works great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2026
A
Verified Purchase
Amazon Customer
Carnegie, US
★★★★★ 5
Best I’ve found yet for facial psoriasis
Anyone who has facial psoriasis will tell you there are not a lot of products that you can put on your face without irritation or flareups. This soap is just what I needed. There are no irritating chemicals or perfumes in this soap. I have read other reviews that the soap does not last very long but there is a way to use it to make it last. First, I wet my face and then I wet my fingertips and rub my finger tips across the dry bar of soap and then lightly rub my face with my fingertips softening the plaques and then lightly wash with a soft cotton washcloth. It is not really moisturizing but not over drying either. I follow up with an organic vegetable-based glycerin oil to moisturize. This is the best product I have found yet.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2020
R
Verified Purchase
Rebekka
Omaha, US
★★★★★ 5
Good for skincare
Not even just good for eczema but also one of the best skincare products i’ve found for dry and dull skin. It does come on a little greasy but it gets absorbed quickly and has a very subtle but nice smell.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products