Pay in installments of $75.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 15 - Aug 20
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
LILRB1/CD85j/ILT2 His Tag Protein, HumanProduct Specification Species Human Accession Q8NHL6 Amino Acid Sequence Gly24 His458, with C terminal 8*His
Product Specification
| Species | Human |
| Accession | Q8NHL6 |
| Amino Acid Sequence | Gly24-His458, with C-terminal 8*His GHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQVAFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLLCQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAHAGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 58-82kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS PH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/mL according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
Leukocyte immunoglobulin (Ig)-like receptor B1 (LILRB1) is a member of leukocyte Ig-like receptors (LILRs), also known as CD85j, ILT2, LIR1, and MIR7, contains four extracellular immunoglobulin domains, and four intracellular ITIMs. It is expressed on monocytes, macrophages, DCs, eosinophils and basophils, mB cells, T cells, and natural killer (NK) cells, as well as on in vitro cultured cord blood-derived progenitor mast cells and osteoclasts. LILRB1 and HLA-I molecule interactions are dependent on the non-polymorphic α3 domain of the heavy chain and β2 microglobulin. LILRB1 additionally interacts with the UL18 molecules from human cytomegalovirus (HCMV), which is an HLA-I homolog, RIFIN molecules from Plasmodium falciparum, Dengue virus through an unidentified ligand, and the damage associated molecular pattern proteins S100A8 and S100A9. Recent studies suggest that LILRB1 on tumor cells stimulates immune responses in certain situations.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy