SKU: 27469110363

Rat CGA Protein, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat CGA Protein, His TagProduct Specification Species Rat Synonyms Glycoprotein hormones alpha chain, Anterior pituitary glycoprotein hormones common subunit alpha, Follicle stimulating hormone alpha chain (FSH alpha), Follitropin alpha chain, Luteinizing hormone alpha chain (LSH alpha), Lutropin alpha chain, Thyroid stimulating hormone alpha chain (TSH alpha), Thyrotropin alpha chain, Cga1 Accession P11962 Amino Acid Sequence Protein sequence (P11962, Leu25 Ser120, with C

Product Specification


Species Rat
Synonyms Glycoprotein hormones alpha chain, Anterior pituitary glycoprotein hormones common subunit alpha, Follicle-stimulating hormone alpha chain (FSH-alpha), Follitropin alpha chain, Luteinizing hormone alpha chain (LSH-alpha), Lutropin alpha chain, Thyroid-stimulating hormone alpha chain (TSH-alpha), Thyrotropin alpha chain, Cga1
Accession P11962
Amino Acid Sequence

Protein sequence (P11962, Leu25-Ser120, with C-His Tag) LPDGDLIIQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKSFTKATVMGNARVENHTDCHCSTCYYHKS

Expression System HEK293
Molecular Weight Predicted MW: 12.3 kDa Observed MW: 24 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Glycoprotein hormones alpha chain (CGA) is a common subunit shared by several pituitary glycoprotein hormones, including thyroid-stimulating hormone (TSH), follicle-stimulating hormone (FSH), luteinizing hormone (LH), and chorionic gonadotropin (CG). It is encoded by a single gene and non-covalently associates with unique hormone-specific beta subunits to form biologically active heterodimers. This 14-20 kDa polypeptide is heavily modified by N-linked glycosylation, which is critical for proper protein folding, heterodimer assembly, and biological activity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27469110363

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
Y
Verified Purchase
Yaya
Battle Creek, US
★★★★★ 5
Works Perfect, No Installation Needed, Perfect Size, and Wonderful Price!
Several months ago when the keys on my laptop mouse pad started to go out, I was really irritated because I have gotten so used to using the mouse pad that I was worried that I wouldn't be able to work as efficiently using a wireless mouse. I knew that it would only be a few days before the keys got to the point that I wouldn't be able to use them and started looking on Amazon for a wireless mouse that I might possibly be able to stand using on a daily basis. I spotted the AmazonBasics Wireless Mouse and thought that it wouldn't be that great because it was way cheaper than most of the other wireless ones that I could find. I went ahead and placed my order because I needed something and thought that if it didn't work that well, I wouldn't be out of that much money. When it arrived, I was happy to see that it was a tad bit smaller than other ones that I have used with desktops in the past since I have small hands. I opened the package, popped in some batteries, plugged the nano receiver into my USB slot, and it was working instantly. I thought that it would take some time to install ( I did not read much on it when I purchased it honestly, I just needed one quick!), but was SO happy to see that it needed nothing to be installed. I have been using this wireless mouse for about a year and half now and I have recommended it to SO many people who were looking for one. I work at home on my laptop 7 days a week and anywhere between 12 - 18 hours a day. I only have to change the batteries about once every two months (sometimes it will go a little longer and sometimes a little bit less - not sure on why though). This mouse has worked flawlessly since the day of purchase and I was SO wrong to think that because it was cheaper than the others that it wouldn't work as well. There has never been a time where it disconnected from the computer or that there was any issue using it. A few times when it has needed the batteries changed and I wait a few days, there is a tiny lag - but that is all my fault. The AmazonBasics Wireless Mouse has a little red indicator light that lets you know when the batteries are getting low and need to be changed. I like that feature so that I'm always aware of when they need to be changed. Since I travel a lot, this mouse is great because it doesn't take up a lot of space in the laptop bag. I also never have to worry about losing the nano receiver because once you remove the little door to the battery area, there is actually a space that the nano receiver clicks into making it perfect for travel. If you are in the market for a great wireless mouse, I would recommend the AmazonBasics Wireless Mouse because it has been through over a year of my all day, everyday use and still works just like the day that I purchased it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2015
J
Verified Purchase
Joe Watanabe
Chelsea, US
★★★★★ 5
It works and is well priced.
This mouse works as well as much higher-priced brand-name items. It fits well in the hand. The durability is very good. Considering the price compared to other brand names, this is a very good value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
M
Verified Purchase
Mark H. in the Garage
Waukegan, US
★★★★★ 4
Solid Everyday Mouse with a Few Comfort Trade-Offs
I’ve been using this Amazon Basics 2.4 GHz wireless optical mouse as a simple, no-frills option, and overall it does exactly what it’s supposed to do. Setup was instant with the USB nano receiver, tracking is accurate, and the wireless connection has been reliable with no dropouts or lag during daily use. It’s lightweight and works well for general browsing and office tasks. Where it falls a bit short for me is ergonomics. Compared to my Logitech mouse, this one doesn’t feel quite as natural or contoured in the hand during longer sessions. It’s by no means uncomfortable, just not as refined in terms of hand fit. That said, for the price and simplicity, it’s a dependable mouse that gets the job done. A solid choice if you want something basic and reliable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 10, 2026
H
Verified Purchase
Hardy
Dallas, US
★★★★★ 5
Love it
I’m honestly impressed with this mouse. The Wireless Optical Mouse works exactly as it should—simple, reliable, and smooth. Setup was instant, just plug in the USB receiver and it’s ready to go. No lag or connectivity issues at all. The tracking is precise, and it feels comfortable even after long use. The battery life is solid, and I like that it goes into sleep mode to save power. It’s lightweight but still feels well-built, not cheap. For the price, this is a great value. If you need a dependable wireless mouse without overpaying for unnecessary features, this is a perfect choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
G
Verified Purchase
Gutale
Houston, US
★★★★★ 5
Amazon basics mouse
Good mouse with hight quality. Works like a charm. I recommend for anyone looking for a cheap high quality Amazon basics mouse. You wont regret it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026

recommand products