SKU: 27928171045

Human VEGF 165, His tag

Sale price$128.25 Regular price$142.50
Save 10%

Pay in installments of $35.62 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human VEGF 165, His tagProduct Specification Species Human Synonyms Vascular permeability factor (VPF), VEGF Accession P15692 4 Amino Acid Sequence Protein sequence (P15692 4, Ala27 Arg191, with C 10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 20. 9 kDa Observed MW: 25 kDa Purity

Product Specification


Species Human
Synonyms Vascular permeability factor (VPF), VEGF
Accession P15692-4
Amino Acid Sequence

Protein sequence (P15692-4, Ala27-Arg191, with C-10*His) APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Predicted MW: 20.9 kDa Observed MW: 25 kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Vascular endothelial growth factor (VEGF or VEGF-A) is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. It is a member of the PDGF family. Humans express alternately spliced isoforms of 121, 145, 165, 183, 189, and 206 amino acids (aa) in length. VEGF165 appears to be the most abundant and potent isoform, contains basic heparin-binding regions and is not freely diffusible. VEGF binds the type I transmembrane receptor tyrosine kinases VEGF R1 (also called Flt-1) and VEGF R2 (Flk-1/KDR) on endothelial cells. VEGF165 binds the semaphorin receptor, Neuropilin-1 and promotes complex formation with VEGF R2. VEGF is required during embryogenesis to regulate the proliferation, migration, and survival of endothelial cells. In adults, VEGF functions mainly in wound healing and the female reproductive cycle. Pathologically, it is involved in tumor angiogenesis and vascular leakage. Circulating VEGF levels correlate with disease activity in autoimmune diseases such as rheumatoid arthritis, multiple sclerosis and systemic lupus erythematosus.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27928171045

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
NMS Johnson
Louisville, US
★★★★★ 1
Must Read before Purchasing!!!! Height is lost if you use this base!!!!
Size: 100LBS
I was so very excited about this for our umbrella - and then I put it together. I called my adult son to come and take a look - I had to be doing something wrong. To our dismay, I was not. The lowest pole in the umbrella system has 4 welded pieces with holes meant to connect to the legs, thus stabilizing the structure. The lowest pole measures (guestimate) 3 feet. When you choose this system, you do not use the original cross-bars, nor the original lowest pole with the 4 welded pieces. Rather, you use a newly provided lowest piece roughly measuring a foot. In doing so, the structure loses a total of almost 2 feet. For average-height individuals, this would not be a problem. For individuals 6' or greater, this is quite a problem. My son is 6'6. My husband is 6'2. I really wanted the portability of the product. However, we will be returning it for the kind that rest on the cross-bars. I wish someone had mentioned this in the reviews I read and saved me the trouble.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 7, 2025
A
Verified Purchase
Amanda Rogers
West Palm Beach, US
★★★★★ 5
From Puppy Teething to Adult Favorite – 7 Years Later
Color: Teething Stick, Color: Teething Stick
This has been one of the best toys I’ve ever bought! My dog has loved the Pupstages Cool Teething Stick since she was a tiny puppy, and now at 7 years old, it’s still one of her absolute favorites. It’s been amazing for soothing teething when she was little, and now she still enjoys chewing on it and carrying it around. It’s held up surprisingly well over the years, especially considering how much use it’s gotten. I also love that you can cool it for extra relief—it really helped during those puppy stages. If you’re looking for a toy that lasts and actually becomes a long-term favorite, this is definitely it. Highly recommend for both puppies and even older dogs who still love a good chew! 🐶
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
M
Verified Purchase
Melissa F
Chelsea, US
★★★★★ 5
LOVE this tough toy! My teething puppy is still enjoying it!
Color: Hedgehog
LOVE the hedgehog! Very tough! My dachshund has not been able to chew off any of the 'nubs', and does she try! lol The only thing is, the first thing she did was chew off the nose, but I discarded it and watched her closely to make sure she didn't chew off any more, and no, its still being chewed on. Wish I could find more toys like this one!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
H
Verified Purchase
Healthy Living and Honest Reviews
Carnegie, US
★★★★★ 5
Perfect First Toy for Tiny Puppies – Lightweight, Engaging, and a Great Value
Color: Teething Stick, Color: Teething Stick
This Cool Teething Stick has been the absolute best first toy for our 1.5 pound puppy! It’s incredibly lightweight, making it easy for even the tiniest pups to pick up, carry, and play with independently. The soft crinkle sound keeps him entertained without being overwhelming, and the little ribbon ends plus the triangular shapes add just the right amount of texture and interest. For the quality, design, and how much joy it brings, the price is unbeatable. At $4.99, this is an easy must-buy for anyone with a young or very small puppy. Highly recommend for a tiny puppy. I do think the durability could be an issue for a large puppy. Keep in mind this puppy is under 2 pounds.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
A
Verified Purchase
Angel Harrison
Omaha, US
★★★★★ 4
My puppy loves it
Color: Teething Stick
It's cute and a good size for my chihuahua puppy. It seems to be slightly tearing at the seam in the middle, but hopefully it will hold up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026

recommand products