SKU: 28822163923

Human IgG1 Fc , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IgG1 Fc , His tagProduct Specification Species Human Synonyms Immunoglobulin heavy constant gamma 1, Ig gamma 1 chain C region, Ig gamma 1 chain C region EU, Ig gamma 1 chain C region KOL, Ig gamma 1 chain C region NIE, IGHG1 Accession P01857 Amino Acid Sequence Protein sequence(P01857, Asp104 Lys330(D239E,L241E), with C 10*His)

Product Specification


Species Human
Synonyms Immunoglobulin heavy constant gamma 1, Ig gamma-1 chain C region, Ig gamma-1 chain C region EU, Ig gamma-1 chain C region KOL, Ig gamma-1 chain C region NIE, IGHG1
Accession P01857
Amino Acid Sequence Protein sequence(P01857, Asp104-Lys330(D239E,L241E), with C-10*His) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEETKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:27.2kDa Actual:30kDa
Purity

>90% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The fragment crystallizable region (Fc region) is the tail region of an antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system. This property allows antibodies to activate the immune system. Fc binds to various cell receptors and complement proteins. In this way, it mediates different physiological effects of antibodies (detection of opsonized particles; cell lysis; degranulation of mast cells, basophils, and eosinophils; and other processes).
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 28822163923

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Experienced Reviewer
Waukegan, US
★★★★★ 5
So soft and pretty Looks great!
Color: Aqua, Size: Throw Size - 50" X 60", Color: Aqua, Size: Throw Size - 50" X 60"
This blanket is wonderful. I'm not sure if it will last or wash well but it's amazing right now. I was looking for something that had a sort of aqua color that would go with my new sheets that are aqua but still blend with my comforter which has more blue tones in it. This worked great as far as the color. I took some pictures and my dog is in them because as soon as I put it on the bed she jumped up and was like "oh thanks Mom ...I love this" That is how soft and luxurious this feels. Others said theirs was shedding. I took mine out of the bag and shook and no shedding. I did have trouble getting it out of the plastic and cut a few pieces with the scissors but once I got it started I just pulled to rip the plastic. I took one pic so you could see the back. I would say it's like a fuzzy microfiber and the color is identical. It's just te right thickness. I love the design. It's warm to lay under but also has a warm look. It was a good value at just under $30. I know some people said it did not wash well but I'll be super careful when I wash it and even though it says hang dry I might tumble on a very low or cool dryer so that it does not mat. If it's a disaster I'll come back to report but prob wont wash it for a few months. Oh and no weird smells out of the bag so that was a plus for me since I have chemical sensitivities.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
M
Verified Purchase
Michael Johnson
Fort Morgan, US
★★★★★ 5
Nice quality! Very soft and comfy!
Color: Aqua, Size: Throw Size - 50" X 60", Color: Aqua, Size: Throw Size - 50" X 60"
So soft and the color is perfect for our room. I love it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026
B
Verified Purchase
Bre McCall - Teague
Fort Morgan, US
★★★★★ 5
Lovely Fluffy Faux Fur Blanket
Color: White, Size: Throw Size - 50" X 60"
Lovely, very soft & lightweight. It is a bit thin causing me to worry it might not be overly warm or durable, yet is just what I was searching for to do a photo project. Thanks!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2026
R
Verified Purchase
Rosanne Betz
Phoenix, US
★★★★★ 5
Beautiful throw
Color: Aqua, Size: Throw Size - 50" X 60"
great quality and so soft and warm......perfect color and good price! very happy with our purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2025
T
Verified Purchase
Tara
Louisville, US
★★★★★ 4
Super Comfortable and Soft
Color: White, Size: Throw Size - 50" X 60"
Feels luxurious and silky soft! It is not very thick but does keep me very warm. In fact I have to kick my legs out sometimes when I’m using it. It does shed A LOT! Will need to update after washing to see if that reduces the shedding. But it is beautiful and comfy. Is give it a 7 out of 10 for quality because of the shedding and the top and underneath pieces are only secured on the edges, which makes it move around and I have to grab the edges and shake to get its form back to normal. I would definitely purchase again. Especially if the shedding reduces it goes away after I run it through a wash cycle. I do NOT recommend drying in the dryer. It will mat I can almost guarantee that. Almost all blankets like these do if you dry them in a dryer with heat. Maybe no heat tumble might work, but NO heat.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 11, 2024

recommand products