SKU: 29612179025

HRSVA (strain A2) Glycoprotein G, His Tag

Sale price$211.50 Regular price$235.00
Save 10%

Pay in installments of $58.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

HRSVA (strain A2) Glycoprotein G, His TagProduct Specification Species HRSV Synonyms Glycoprotein G, G, mG, Attachment glycoprotein G Accession P03423 Amino Acid Sequence Ser64 Gln298, with C terminal 8*His SANHKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQGGGSHHHHHHHH Expression System HEK293 Molecular Weight

Product Specification


Species HRSV
Synonyms Glycoprotein G, G, mG, Attachment glycoprotein G
Accession P03423
Amino Acid Sequence Ser64-Gln298, with C-terminal 8*His SANHKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 90-95kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.
Reference

1、Melero J A. et al. (1997) Antigenic structure, evolution and immunobiology of human respiratory syncytial virus attachment (G) protein. J Gen Virol. 78 (10): 2411-2418.

2、Trento A. (2006) Natural history of human respiratory syncytial virus inferred from phylogenetic analysis of the attachment (G) glycoprotein with a 60-nucleotide duplication. J Virol. 80(2): 975-984.

Background

HRSV is a member of the Pneumovirinae subfamily in the Paramyxoviridae family. It consists of a non-segmented, single-strand negative RNA genome packaged in a lipid envelope. The genome of HRSV is about 15.2 kb in length and encodes 10 genes and 11 proteins: NS1, NS2, N, P, M, SH, G, F, M2-1, M2-2, and L. The F protein and G protein are the major surface glycoproteins. Both of them can stimulate the production of neutralizing antibodies. The sequence of the F protein is highly conserved, while that of the G protein is hypervariable. Due to the genetic diversity in the G gene, sequence encoding the second hypervariable region in the C-terminal (HVR2) of the G protein has been used for genotyping of HRSV. According to the genetic characteristic and reactivity with monoclonal antibodies, HRSV is classified into 2 subgroups, A (HRSVA) and B (HRSVB). To date, there are 15 genotypes of HRSVA (GA1-GA7, SAA1, CB-A, NA1-4 and ON1-2), and 24 genotypes of HRSVB (GB1-GB4, SAB1-SAB4, URU1-2, BA1-12, GB5/CB1 and CBB).
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29612179025

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Busy Book Bee 📚
Lexington, US
★★★★★ 5
I LOVE this book so much!!!!!
Format: Kindle
WOW what a ride!!! To Bleed A Kingdom is Ella Dawes debut book and I am thoroughly impressed by her writing! She writes like a seasoned author already! I absolutely LOVE her writing style it’s fun easy to follow and very imaginative and expressive where a reader can actually FEEL what the characters are going through or have gone through. This world and the characters in it are so very relatable so real feeling like they could actually be my family and friends and enemies also lol The mystery surrounding Lena her friends or found family and their lives is not reveled wholly in this book we get pieces and I really loved that, normally I’m very impatient but with the way this world and all the characters are written it doesn’t become so much the main focus. We get a really solid feel for this world and all it’s going on and people in it. New friendships and love interests are formed it’s a very character driven story which I personally love!! Lena is beautifully broken and flawed but sooooo incredibly strong without the unnecessary stubbornness we come across in so many books and what a breath of fresh air that was to read! Darius is an Alpha male through and through with a LOT of emotional trauma but he loves and he loves hard even when he doesn’t really realize it himself. The side characters are phenomenal the dialogue is sooo good the banter is hilarious and the loyalty and love between them all is written beautifully! The spice is little but it’s amazing when it happens wink wink I don’t like cliffhangers especially when I’m not sure when the next book will be released I’ve been burned too many times but once I got started reading this I didn’t stop all day and late into the night so I’m going to have find my patience and wait and I am so very excited to see where Ella takes this story. Thank you for sharing this story with us can’t wait for more!!! I read this on KU
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2024
R
Verified Purchase
ROlander
Lake Worth, US
★★★★★ 4
A Dark Fantasy that hooks you from the start!
Format: Kindle
⭐️⭐️⭐️⭐️ 🌶️🌶️ Right from the prologue, I was hooked. Ella wastes no time diving into an intense scene, but definitely be sure to read the trigger warnings! I was immediately drawn into this dark fantasy world, and even more so by the slow-burn tension, witty banter, and the strong sense of family that forms throughout the story. What I really loved is that Darius, the Queen’s illegitimate son and captain of the guard, is the main focus of the book. Broken and struggling to navigate the prejudices against him, Darius is caught between playing the political games and wanting to be accepted. He’s also investigating a growing threat: demons, who have always been a manageable evil, are suddenly multiplying and attacking in larger groups. His focus shifts when Lena, a mysterious foreigner with an aura that can’t be ignored, arrives on the scene. She’s not quite human—something other—and I found myself just as captivated as Darius, trying to uncover who she is and what role she has in his life. The tension and spice had me reading into the late hours of the night - romantasy readers are going to devour this book! This book also does an excellent job of challenging stereotypes, labels, and unconscious bias. I love how Ella seamlessly weaves these complex themes into the plot, and how the characters navigate them in ways that feel authentic and thought-provoking. 🎧 ⭐️⭐️⭐️⭐️ Another highlight was the narration by Laura Horowitz! She does an amazing job bringing the characters to life with different accents and voices, capturing Amara’s sassiness and Lena’s mysterious nature perfectly. It took me a little while to adjust to Darius' narration, though—it wasn’t quite what I had imagined for him or other male characters. But once I sped it up to 2.0, it felt much better. As for Kace and Griffin, I still struggled a bit with their voices, especially Kace, whose tone came off more like a silly jester than the commanding yet light-hearted character I envisioned.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2025
A
Verified Purchase
Ashley
Natrona Heights, US
★★★★★ 5
My current fave! Total must-read!
Format: Kindle
To Bleed a Kingdom" is an absolute rollercoaster of a read that I couldn't put down! From the get-go, Dawes throws you into the thick of it with a horrific scene that sets the stage of Seboia. It will leave you in shock. Major trigger there, but honestly, I will say it was done so tastefully I really appreciated having it on the offset! Then we meet the brooding, forgotten Captain Darius. He’s a mountain of a man, terrifying, but has an absolute heart of gold. He’s fighting to protect his Kingdom in the midst of immense chaos from the terrifying Soulless. And then there's Lena, a fierce and intelligent leader who swoops in and turns Darius's world upside down. Their attraction to one another is seriously unwanted, particularly with all that’s going down. But it’s absolutely intoxicating and I can not get enough of it! But it's not just about the romance – oh no! Dawes is a master story teller, weaving in elements of suspense, mystery, a world of gods and fiendish supernatural creatures, and that much needed banter in a story like this. Lena and her gang of misfits are a riot, reminding me of the antics I used to get up to with my own sister. And let's talk about Darius's backstory – it's totally gut-wrenching, and so you’re instantly in love. I mean, who doesn't love a brooding, tortured hero? But the real star of the show here is the world-building. Dawes has created a rich and intricate universe filled with gods, fae, and supernatural creatures that all weaves in perfectly. The way she integrates gems and their significance is genius, adding a whole new layer to the story. If you're a fan of epic dark fantasy with a paranormal twist, this is the book for you. And don't even get me started on that cliffhanger – I'm already counting down the days until book two hits the shelves! Definite must-read.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2024
J
jabberray
Birmingham, US
★★★★★ 3
Why can't they just TALK to each other?!
Format: Kindle
The prologue to this book was bloody and violent. I actually started this book then put it away for several months as I found it not enjoyable. When I finally returned to the book, I pretty much skipped the prologue and went right in. There are a lot of holes in this story, a lot of repetitive sections, and several parts (mostly the whole book) where you just want the lead characters to talk to each other instead of being petty and jealous. Who the female lead is, is never really explained. The humans are considered weak, but the human kingdom is the one they fear, just really weird. I did finish the book and it was overall a good book, and I may actually read the second book to see if any questions are answered and holes in the story filled in. Don't take that as an endorsement, if it was a really good book I would be reluctant to read more as I wouldn't want the story ruined, but just being so-so, there is nothing to ruin and maybe the next will be better. If you're on the fence stay there until you run out of better options, then give it a go.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2025
C
Verified Purchase
Chaos & Courtships
Waukegan, US
★★★★★ 5
A Stellar Dark Romantasy Debut
Format: Kindle
4.5 ⭐️ Yet another stellar debut from a promising new indie author! This dark fantasy romance was a fast-paced, thrilling ride, brimming with high stakes action and slow burn romance. The story was refreshing and original, and I can’t wait to see what this author comes up with next. There was just enough world building to keep the story interesting, without overtaking the entire story. And I was fully invested in these characters, both the major players and the supporting cast. I loved the sprinkling of humor and playful banter between the whole ensemble. Even though the book encompasses some darker themes, these moments of levity created a beautiful balance within the story. I enjoyed the dynamic between Lena and Darius- there was a bit of an Insta-love situation, which can be tough trope for me to swallow. But they had some beautiful chemistry and banter, so it ended up all working for me. Still a lot of answers are left to be uncovered regarding Lena, which I’m sure will be addressed in the next book. Looking forward to seeing where everything goes, especially after the cliffhanger ending. 💀 All in all, an absolutely solid debut, and I am fully invested in this story. This author is definitely gonna make her mark in this genre. ✨Morally grey MMC ✨Strong FMC ✨Banter and humor ✨Touch her and 💀 ✨Found family ✨Shifters & fae ✨Unique magic system ✨Dual POV 🌶️Slow burn that leads to spice (1.5)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2024

recommand products