Pay in installments of $70.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 9 - Aug 14
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
EphA6 His Tag Protein, HumanProduct Specification Species Human Antigen EphA6 Synonyms Ehk2 Protein, Hek12 Protein, m ehk2 Protein Accession Q9UF33 Amino Acid Sequence Typ23 Val550, with C terminal 10*His
Product Specification
| Species | Human |
| Antigen | EphA6 |
| Synonyms | Ehk2 Protein, Hek12 Protein, m-ehk2 Protein |
| Accession | Q9UF33 |
| Amino Acid Sequence | Typ23-Val550, with C-terminal 10*His WPGDCSHVSNNQVVLLDTTTVLGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLFYMESDESHGIKFKPNQYTKIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGYFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDAPSLIGVVRKDWASQNSIALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIITGLKPATKYVFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQILVGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 65-73kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1． Gitanjali Das, Qili Yu, Ryan Hui, Kenneth Reuhl, Nicholas W. Gale & Renping Zhou Cell & Bioscience volume 6, Article number: 48 (2016). |
Background
Ephrin-a receptor 6, also known as EphA6 or EHK2, belongs to the Ephrin receptor subfamily of the protein tyrosine kinase family. The Eph family is the largest group of related receptor tyrosine kinases known, consisting of 16 members in the vertebrate genome. Eph receptor and its ligand ephrin play an important role in neuronal migration, axon binding and specific target guidance, dendritic spine formation and neuroplasticity. Studies have shown that EphA5 and EphA6 are significantly expressed in perinatal development and in the cerebral cortex of adult mice, so EphA5 and EphA6 play an important role in regulating the cellular structure of cortical neurons.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy