SKU: 32818431215

Human CY211, His Tag

Sale price$157.50 Regular price$175.00
Save 10%

Pay in installments of $43.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CY211, His TagProduct Specification Species Human Synonyms Cy211 Accession P08727 Amino Acid Sequence Protein sequence(P08727, Ser239 Leu400 with C 10*His) SAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 20kDa Actual: 22kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms Cy211
Accession P08727
Amino Acid Sequence

Protein sequence(P08727, Ser239-Leu400 with C-10*His)


SAPGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVLGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 20kDa Actual: 22kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Cytokeratin 19 fragment antigen (Cy211) belongs to a cytokeratin family, which is normally expressed in epithelial tissues and forms the epithelial cells’ filament cytoskeleton. Cy211 is useful as a tumor marker, especially for non-small cell lung cancer (NSCLC) along with carcinoembryonic antigen (CEA) and squamous cell carcinoma–associated antigen (SCC), but also for other epithelial tumors such as bladder cancer. This elevation in tumors may be due to cell lysis, releasing cell contents to the blood, including Cy211 by the action of proteases that degrade the cytokeratin filaments 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 32818431215

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Julie Mergel
Boise, US
★★★★★ 5
It's so easy to move around!
Color: Dark Mocha, Size: 8 Panel
This room divider is beautiful and is very light to move around. Also, it is vdry affordable. It works perfect in the space that I bought it for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
S
Verified Purchase
S BROWN
Belleville, US
★★★★★ 5
Great divider for outside privacy also
Color: Black, Size: 8 Panel, Color: Black, Size: 8 Panel
This divider fit the bill as far as a solution for privacy between houses. I’ve had it for over a year and it’s held up very well. So well, and I’m adding another one on the other side of the property. Easily put up and in this case, I just attached it with bungee cords to keep it from blowing over in the wind. Very well-made and attractive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2025
J
Verified Purchase
JMR
Louisville, US
★★★★★ 5
Great purchase
Color: Dark Mocha, Size: 8 Panel
Great quality just what I needed for the space!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
V
Verified Purchase
Vanessa Rivera
Port Orchard, US
★★★★★ 5
Stylish and very functional for a primary bathroom
Color: C. Black, Color: C. Black
I installed these shelves in my primary bathroom and I’m very happy with the result. The design is clean and modern, and it helps keep the space organized without looking cluttered. I really like the combination of the solid shelf and the wire basket—it’s perfect for storing towels, toilet paper, and a few decorative items. The materials feel sturdy and well made, not cheap or flimsy. Installation was straightforward and didn’t require anything complicated. It definitely upgraded the look of my bathroom and made better use of the vertical space. Great option for a primary bathroom if you want both function and style. I would recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 22, 2026
Y
Verified Purchase
Yaima Blanco
Grantham, US
★★★★★ 5
Sleek and Minimalist Bathroom Shelf
Color: A. Brown, Color: A. Brown
I recently got this bathroom shelf, and I love it! The minimalist design looks super clean and modern, and it fits perfectly in my bathroom without taking up too much space. The build quality is great—it feels sturdy and well-made, and it holds my toiletries easily. Installation was simple, and it really helps keep things organized. Overall, it’s a stylish, practical addition to any bathroom. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2026

recommand products