Pay in installments of $27.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 21 - Jul 26
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
SerpinB3/SCCA Protein, HumanProduct Specification Species Human Synonyms SerpinB3, SCCA1; Serpin B3, Protein T4 A, Squamous cell carcinoma antigen 1, SCCA 1,serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3, serpin peptidase inhibitor, clade B (ovalbumin), member 3, Squamous cell carcinoma antigen 1, T4 A,SCCA1 Accession P29508 Amino Acid Sequence
Product Specification
| Species | Human |
| Synonyms | SerpinB3, SCCA1;Serpin B3, Protein T4-A, Squamous cell carcinoma antigen 1, SCCA-1,serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3, serpin peptidase inhibitor, clade B (ovalbumin), member 3, Squamous cell carcinoma antigen 1, T4-A,SCCA1 |
| Accession | P29508 |
| Amino Acid Sequence | MHHHHHHDDDDKNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP |
| Expression System | E.coli |
| Molecular Weight | 45.9 kDa |
| Purity | ＞90%, by SDS-PAGE under reducing conditions |
| Endotoxin | <2EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris-HCl, 150mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation . |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
SerpinB3/SCCA belongs to tumor-related glycoprotein antigen, also known as TA-4 antigen, which widely exists in the cytoplasm of uterine, cervical, lung and other squamous cell carcinoma, and has a high content in non-keratinized cancer cells, which is closely related to the occurrence and development of squamous cell carcinoma. In normal squamous epithelial cells, SerpinB3/SCCA inhibits apoptosis and participates in the differentiation of squamous epithelium, but participates in the physiological processes such as invasion, metastasis and recurrence of cancer cells in tumor cells. As a specific marker of squamous cell carcinoma, the concentration of SerpinB3/SCCA increases with the aggravation of the disease, and it is an important tumor marker reflecting the biological characteristics of squamous cell carcinoma. Its serum level is widely used in the diagnosis of squamous cell carcinoma of many organs and clinical evaluation of therapeutic effect.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy