SKU: 3501838558

FABP3 His Tag Protein, Human

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 6 - Aug 11

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP3 His Tag Protein, HumanProduct Specification Species Human Accession P05413 Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Expression System E. coli Molecular Weight 15. 7 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Human
Accession P05413
Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Expression System E.coli
Molecular Weight 15.7 kDa(Reducing)
Purity

95%,  by SDS-PAGE under reducing conditions

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid-binding protein 3 (FABP3) is a cytosolic protein found in various tissues, including heart, skeletal muscle, intestinal mucosa, liver, and kidney. It is also highly expressed in the adult brain, particularly in the pons, frontal lobe, and hippocampus. In the brain, FABP3 regulates the lipid composition of the membrane and transports fatty acids between different intracellular compartments. It is released extracellularly after neuronal damage and high cerebrospinal fluid (CSF) concentration of FABP3 is found in acute conditions, such as brain injury and stroke. CSF FABP3 concentration is also higher in conditions with neuro degeneration/neuronal damage, e.g., Alzheimer’s disease (AD), mild cognitive impairment (MCI) due to AD, dementia with Lewy bodies, and Creutzfeldt–Jakob disease. CSF FABP3 concentration correlates with cognitive decline and are associated with brain volume loss in areas selectively affected in early AD. Thus, FABP3 is suggested to be a general marker of neuronal damage.

 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3501838558

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Aury
Louisville, US
★★★★★ 5
Easy and convenient to use
Love my product is easy to use, I truly recommend 100% price and quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
L
Verified Purchase
Librax2
Grantham, US
★★★★★ 5
Knowledgeable and helpful
I purchased a new Sony TV and was having a lot of trouble coordinating the settings. After struggling for 1.5 days, I gave up and called the number for Asurion. There was a reasonable wait while I found the "right" tech person, but it was worthwhile. He was knowledgeable and patient. He gave me confidence and we worked together to solve all my issues. At the end he became pressuring, wanted me to buy a monthly gig with them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2026
B
Verified Purchase
Bob P.
Belleville, US
★★★★★ 5
They honor their product.
I've been dealing with Asurion for over a decade now. They're my first choice when making a purchase that I know I'm going to have around for a while. Asurion backs its product to the hilt. I purchased a mid-range priced printer about 2 1/2 yrs. ago along with a 3yr. warranty from Asurion to cover any unexpected 'surprises' that might happen to pop up. Fast forward to approximately 3 months ago, when my printer decided that it wanted to start acting up. The print quality was taking a nose dive; colors were beginning to drop out, showing streaks and fading. Clarity and sharpness are virtually gone. I contacted Asurion about the problem. I couldn't have found a nicer rep to deal with. She said not to worry and within minutes had the situation under control. She sent me all the information and pre-paid postage on how to pack and have my unit shipped to their repair facilities. In less than a week my unit was repaired and returned to me. However, this is not the end of the story. Within a few days, my unit was acting up again and doing the same thing it went in for. Again, I got hold of Asurion (Same great service, different girl). We repeated the same process as before, but this time the unit was there about a week longer. When I finally received the unit, I immediately hooked it up and put it through the numbers, testing everything. To be blunt, the print quality was worse than the 1st time it went in for service. After voicing my displeasure (basically having a hissy-fit), I regained my composure and contacted Asurion, again! This time they told me that since their techs were unable to resolve the issue and to not have me waiting any longer than I have already, they're going ahead and refunding the total amount I paid for the unit. Even though it was somewhat of a Pain-in-the-ASS to go through, I couldn't be happier. Within 48 hrs. I had my refund in hand and I turned around and purchased a replacement Printer. Moral to the story, have a contingency plan, Just in case. Check out Asurion: Great customer service - Nice people, very competitive pricing for their products and they honor their word by their actions. Highly recommend Asurion to anyone.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2024
D
Verified Purchase
Demi
Birmingham, US
★★★★★ 4
Protection plan
Good
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
S
Verified Purchase
steve conley
San Leandro, US
★★★★★ 5
never give up
Product was as advertised even though item was over a year old, I was taken care of.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 12, 2026

recommand products