SKU: 35639463881

Human Adiponectin, his tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Adiponectin, his tagProduct Specification Species Human Synonyms 30 kDa adipocyte complement related protein, Adipocyte complement related 30 kDa protein (ACRP30), Adipocyte, C1q and collagen domain containing protein, Adipose most abundant gene transcript 1 protein (apM 1), Gelatin binding protein, ACDC, ACRP30, APM1, GBP28 Amino Acid Sequence Protein sequence (Q15848, Glu19 Asn244, with C 10*His)

Product Specification


Species Human
Synonyms 30 kDa adipocyte complement-related protein, Adipocyte complement-related 30 kDa protein (ACRP30), Adipocyte, C1q and collagen domain-containing protein, Adipose most abundant gene transcript 1 protein (apM-1), Gelatin-binding protein, ACDC, ACRP30, APM1, GBP28
Amino Acid Sequence

Protein sequence (Q15848, Glu19-Asn244, with C-10*His) ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 26.2 kDa Observed MW: 34 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Adiponectin (also referred to as GBP-28, apM1, AdipoQ and Acrp30) is a protein hormone and adipokine, which is involved in regulating glucose levels and fatty acid breakdown. In humans, it is encoded by the ADIPOQ gene and is produced primarily in adipose tissue, but also in muscle and even in the brain. Adiponectin is secreted from adipose tissue (and also from the placenta in pregnancy) into the bloodstream and is very abundant in plasma relative to many hormones. High adiponectin levels correlate with a lower risk of diabetes mellitus type 2. Adiponectin exerts some of its weight-reduction effects via the brain. This is similar to the action of leptin; adiponectin and leptin can act synergistically. Adiponectin promoted synaptic and memory function in the brain. Humans with lower levels of adiponectin have reduced cognitive function.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35639463881

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
C. Dickerson
Los Angeles, US
★★★★★ 5
Easy recommendation
Style: For Him
Actual reviewer, not paid to make this, nor was incentivized. Great value - these soaps last around 3 months each. Scents are non-offensive, soap doesn't leave my skin dry, and I feel clean afterward. They also lather up really well!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
T
Verified Purchase
This little roller is great works better than higher priced machines and you get the cleaning kit with it . recommend this to anyone just starting to roll their own . quality and affordability I like it
Belleville, US
★★★★★ 5
Great soap
Style: For Him
Luv this soap better than the Dr. Squash soap so far . It lathers good cleans ,no film , and luv the smell of it . I will most definitely buy again . It's my soap from now on for sure . Luv everything about it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
M
Verified Purchase
Matt C.
Chelsea, US
★★★★★ 3
IMMEDIATE REACTION, PLUS FOLLOW UP AFTER A WEEK!
Style: For Him
**Package arrived LITERALLY 5 minutes ago, here is my immediate initial reaction, and then I'll actually post this after USING the soap and getting a better feel for the product.** Keeping in mind that smell is subjective, here are my knee jerk thoughts on the bars of soap: - Firstly, I can smell the soap through the bag (and box). Whatever scent this is, it's POTENT. - Opening the box, the bars of soap look a LITTLE small. Not egregiously so, but a little bit smaller than your average bar of soap; BUT I check them against a new bar of Dove soap that I have, and they are identical. The eyes are playing tricks on you with these. - Here is the breakdown of the 6 scents - Activated Charcoal. This is what I was HOPING would smell like the "Pine Tar" that other companies (like Dr. Squatch, which I've never used, btw) have, but it is the "soap-est" smelling soap, with a hint of tar. It smells a little bit like a can of new paint. - Tango Mango. IMHO, the best smelling of the 6, with strong citrus smells. Very lemon-y, but pleasant. - Eucamint. Ahhh, here's what was permiating out of the box. This smell is STRONG, with an AGGRESSIVE mint smell. Like, Ben Gay mint. And as strong to boot. It doesn't smell BAD, but it's hands down the strongest scent. - Oatmeal Shea. Meh. Kinda smells like an old coat that would be hanging in your grandfathers closet. It's not a BAD smell, but it has this weird odor to it, like when you leave a can of peanuts in your cupboard for a long time, and then go back and smell it. - Patchouli Lime. This one kind of smells like a mixture of Activated Charcoal, Eucamint and Oatmeal Shea. It smells like a room that you just painted a day or two ago, and it definitely has the Ben Gay after aroma lingering. - Apline Spice. This smells like a box. Like find an empty cardboard box, open it, and take a whiff. Boom, Alpine Spice. My least favorite. I will say, none of them STINK; as in there isn't a smell that I'm like, "ewww, I don't want to smell like AT ALL!" Which sounds weird, because I described some of them as "paint," "an old coat," and "a cardboard box," but I feel that those are just very passive smells, not aggressively bad ones. If there is a problem soap, I would assume it's going to be Eucamint, because it might just be too overpowering, although I've found that the more you smell them, they seem to mellow out. I imagine that after a shower with these, the smell will dissipate enough that it will be more mild. Still, with the exception of Tango Mango; a very good smelling soap mind you, I'd say they are all very "manly" scents, and I'm excited to try them out. Ok, so I'm a little over a week in, and here's my final take. (I made it through Activated Charcoal and Tango Mango): First, the scents ABSOLUTELY mellow out when used to actually shower with them. My wife, who admittedly isn't really up on me like that, hasn't even mentioned me smelling differently than the last 11 years. So, if she's even noticed, it's not on a level to make a fuss about. This is important because fresh from the box, these things have some powerful scents, but they are definitely tamed by washing with them. The bars last ABOUT 7 showers. Obviously, your mileage will vary based on how long you're in the shower, how much you scrub, how you store them, etc, but I was able to get 7 GOOD showers out of these. I have them in these natural sisal (whatever that is) exfoliating bags that help lather and store the soap, and really did some good scrubbing in my showers. The bars lather decently, but I'm not sure how much the bag helps with that. If you are a once a day showerer, a bar a week is a very fair approximation of what you'll get. I definitely felt.....SOMETHING I didn't before with my shower gel showers. I don't know if that's the moisturizing, or the exfoliation, but my skin felt a little different after showering. A decent buy. I'm not thrilled, but I'm not upset either. I don't think it changed my life, or even the way I shower, but I'm not mad at the experiment. I may try the Dr. Squatch soaps to see how all these stack up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2020
J
Verified Purchase
Jessica
Louisville, US
★★★★★ 5
Convinced to make the switch
Style: Citrus
Love this soap. I was using Jukebox, but I'm making the switch. Crate 61 feels better on my skin, the bars last a little longer and the 6 pack is $15 cheaper than I was paying for 6 bars with the Jukebox subscription. I get extremely dirty at my job so I tend to go through soap faster than the average women. Jukebox bars would last me about 4 days. These will last 6 or 7 days. Jukebox bars were a definite upgrade from body wash, but it would irritate the sensitive areas. I don't have that issue with this soap. Jukebox bars smell nice in the shower, but I feel like the scent didn't last beyond that. Crate 61 leaves a pleasantly subtle smell on my skin after showering. The only benefit with Jukebox is that you can choose the individual soaps in your 6 pack, rather than selecting one of the collections.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
A
Verified Purchase
Anna DeHamer
Dallas, US
★★★★★ 5
Good smells, better clean
Scent: Assorted, Scent: Assorted
This Rinse & Robust 4-pack men’s soap is a great option for anyone looking for a refreshing and rugged scent in their daily routine. The bars come in four distinct manly fragrances—Santal, Leather, Charcoal & Clove Oil, and Cedar Citrus—which provide a long-lasting clean feeling. Made with natural ingredients like oat, green tea extract, and coconut oil, these soaps offer both exfoliation and moisture without harsh chemicals like sulfates or parabens. The 4-in-1 design makes them versatile for body, hands, face, and even shaving, making skincare simple and convenient. Packaged in a sleek gift box, this set makes an excellent gift for any man who appreciates high-quality grooming products.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 29, 2025

recommand products