SKU: 39350345118

Cyclophilin A His Tag Protein, Human

Sale price$94.50 Regular price$105.00
Save 10%

Pay in installments of $26.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Cyclophilin A His Tag Protein, HumanProduct Specification Species Human Antigen Cyclophilin A Synonyms Peptidyl prolyl cis trans isomerase A, PPIase A, Cyclosporin A binding protein, Rotamase A Accession P62937 Amino Acid Sequence Met1 Glu165, with C terminal 8*His MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEHHHHHHHH Expression System E. coli Molecular Weight 20kDa

Product Specification


Species Human
Antigen Cyclophilin A
Synonyms Peptidyl-prolyl cis-trans isomerase A, PPIase A, Cyclosporin A-binding protein, Rotamase A
Accession P62937
Amino Acid Sequence

Met1-Glu165, with C-terminal 8*His MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLEHHHHHHHH

Expression System E.coli
Molecular Weight 20kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris,250mM NaCl, pH 6.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Cell Death Dis. 2013 Oct 31;4(10):e888.
2. Biochemistry (Mosc). 2022 Mar;87(3):259-268.

Background

Cyclophilin A (CyPA, 18 kDa) is a ubiquitously distributed protein belonging to the immunophilin family. Cyclophilin A (CyPA) is a peptidyl-prolyl cis-trans isomerase that exists in the intracellular and secretory forms and has multiple functions. Intracellular CypA takes part in folding, transport, and assembly of proteins; regulates cell proliferation; is a ligand for cyclosporine A (CsA), mediating its immune-suppressive activity; mediates signal transduction from a T cell receptor, and controls the balance of T helpers 1 and 2, inhibiting activity of T helpers 2.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39350345118

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Riley
Battle Creek, US
★★★★★ 5
Perfect spoons for everyday use
Size: Large Pack
We use these daily. I buy the complete set then boxes of each to refill. Very sturdy utensils. Size is perfect. Very easy to clean to use after dinner for deserts. Only brand we use now. Great for cereal and ice cream. Very thick and have never had any break. Great value for the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2026
H
Verified Purchase
Hannah
Cuba, US
★★★★★ 5
I buy these frequently!
Size: Large Pack
Great quality plastic wear at a good price. I buy these through Amazon all the time and have never been disappointed. The size and sturdiness is great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
T
Verified Purchase
Tessie Adkins
Pawtucket, US
★★★★★ 5
Hard to break
Size: Large Pack
I am a mother of five so buying plastic wear has become my life. I'm insanely picky about them. These pass all my tests. They do NOT break easy. They are light when eating, not much weight to them. Great value for the price. I'm a mother, I have to get my "bang for my buck" and these are what's it for me. I have repeat bought these study little pieces of magic. With an autistic child they make my life easier and the fact they don't snap 🫰 easily is a super win.... Bc it's NOT FOR LACK OF TRYING 😂
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
M
Verified Purchase
Mookie Long
Omaha, US
★★★★★ 5
Spooniest spoons that ever spooned
Size: Large Pack
I don't know how excited anyone can get about spoons, but hey, they spooned. Decent thickness because they didn't snap when I took a scoop of soup or chili or whatever I had. They look like spoons. They're the size of spoons although I wish all disposable spoons had more surface area in the scoopy part of the spoonage. Really good price for what you're getting and I'm being prompted to comment on ease of use. If you need to know anything about how easy or difficult using a spoon is, you probably shouldn't be using one, supervised or otherwise. Spoon on!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
C
Verified Purchase
Charlie Price
Lowell, US
★★★★★ 5
Durable and versatile disposable spoons
Size: Large Pack
These plastic spoons are sturdier than most disposables I've tried, holding up well to both hot soup and frozen desserts without bending. The pack of 100 means I always have plenty on hand for home meals, lunches and picnics, and the clear design looks nicer than flimsy white utensils. I appreciate that they are safe to use and made from food-grade, BPA-free plastic. While the handles are hollow, they've been strong enough for cereal, yogurt and everyday use. They provide great value for the price and save me from washing dishes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026

recommand products