SKU: 42227630612

Human GFRAL Protein, His Tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GFRAL Protein, His TagProduct Specification Species Human Synonyms GFRAL, C6orf144 Accession Q6UXV0 Amino Acid Sequence Protein sequence (Q6UXV0, Ser19 Glu351, with C His Tag)

Product Specification


Species Human
Synonyms GFRAL, C6orf144
Accession Q6UXV0
Amino Acid Sequence

Protein sequence (Q6UXV0, Ser19-Glu351, with C-His Tag) SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Expression System HEK293
Molecular Weight Predicted MW: 39.5 kDa Observed MW: 35-45 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

GFRAL is a receptor primarily expressed in the hindbrain and binds to the hormone GDF15. It plays a key role in metabolic regulation, mediating appetite suppression and body weight control in response to stress, inflammation, or disease. GFRAL activation triggers downstream signaling through the RET coreceptor, influencing energy homeostasis. Its association with GDF15 has made it a potential therapeutic target for obesity and metabolic disorders.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 42227630612

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jonathan Heacox
Lowell, US
★★★★★ 5
Works great; As Advertised.
Color: Black-Phone Holder-31.5"x15.8"
Love this pad with wireless charging. Doesn't come with a charging brick but does come with everything else you need.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
C
Verified Purchase
Cute Crissy
Draper, US
★★★★★ 5
Mouse Pad Charger
Color: Black-27.5"x11.8"
I absolutely love the mouse pad. It fits my 17.3 inch laptop nicely and my mouse. It's great for charging my phone next to me while I work. Unfortunately, it does not work for the Air Pods. It must be for an older version. Nonetheless, it's still a great buy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
P
Verified Purchase
Paul Mills
West Palm Beach, US
★★★★★ 5
A good product
Color: Black-27.5"x11.8"
Size is accurate and this is important in my situation as I use a pull out key tray and wanted edge to edge coverage. Depth is good but in my case I would have liked a deeper dimension as an option. Phone charger works well, the mouse slides smoothly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
J
Verified Purchase
Josey
Bozeman, US
★★★★★ 3
Will not charge your phone
Color: Black-Stock Market-31.5"x15.8"(with Wall Charger)
I love this mat, but it doesn't do what it says... I bought this mat for the candlesticks! The charging station was a bonus. It is very large and covers my working area, which I like. But when I go to charge my phones, it doesn't work! I placed my Android phone on the magnetic charging circle, and it showed the lightning bolt charging icon. I looked at it 5 minutes later to see how much it charged, and it was at the same % when I put it on, and the lightning bolt was gone. I tried three times, and it never charged! I then tried with my Apple phone, and the same thing, it doesn't charge. Buy this for the mat's aesthetics only; don't expect it to charge phones or earbuds...
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 6, 2026
L
Verified Purchase
linda Catanzariti
Massapequa, US
★★★★★ 5
Cute jewelery holder
Color: C Blue
I was looking for something simple to hold some necklaces and earrings. I do the have much because I'm not much into jewelry but I didn't want to just sit them in a bathroom drawer. This jewelry rack is so convenient and doesn't take up a lot of room. Fits the bill just right.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026

recommand products