Pay in installments of $25.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human Calprotectin（S100A8）, His tagProduct Specification Species Human Synonyms Calgranulin A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor related protein 8 (MRP 8; p8); Urinary stone protein band A; CAGA Accession P05109 Amino Acid Sequence Protein sequence(P05109, Met1 Glu93, with C 10*His) MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEGGGGSHHHHHHHHHH Expression
Product Specification
| Species | Human |
| Synonyms | Calgranulin-A; Calprotectin L1L subunit; Cystic fibrosis antigen (CFAG); Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8 (MRP-8; p8); Urinary stone protein band A; CAGA |
| Accession | P05109 |
| Amino Acid Sequence | Protein sequence(P05109, Met1-Glu93, with C-10*His) |
| Expression System | E.coli |
| Molecular Weight | Predicted MW: 12.5 kDa Observed MW: 13.0 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
S100A8 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis and post COVID-19 condition.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy