Pay in installments of $90.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 19 - Jul 24
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
PCSK9 His Tag Protein, RatProduct Specification Species Rat Synonyms PCSK9, FH3, PC9, FHCL3 Accession P59996 Amino Acid Sequence Gln31 Gln691, with C terminal 10*His
Product Specification
| Species | Rat |
| Synonyms | PCSK9, FH3, PC9, FHCL3 |
| Accession | P59996 |
| Amino Acid Sequence | Gln31-Gln691, with C-terminal 10*His QDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLERIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRLILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAARAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEEATVAAAICCRSRPSAKASWVHQGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-70kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Jaén R I. et al. (2022) Functional Crosstalk between PCSK9 Internalization and Pro-Inflammatory Activation in Human Macrophages: Role of Reactive Oxygen Species Release. Int J Mol Sci. 23(16): 9114. |
Background
PCSK9 (proprotein convertase subtilisin-kexin type 9) is a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. PCSK9 undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Atherosclerosis is a cardiovascular disease caused mainly by dyslipidemia and is characterized by the formation of an atheroma plaque and chronic inflammation. Proprotein convertase subtilisin/kexin type 9 (PCSK9) is a protease that induces the degradation of the LDL receptor (LDLR), which contributes to increased levels of LDL cholesterol and the progress of atherosclerosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 30 reviews
Sort
Product Reviews
★★★★★ 5
Sturdy paper bowls, economical quantity purchase
Size: 300 Count
I previously bought 50 (?) of the paper plates to check the quality and see how well they hold up before making quantity purchases of other paper products. The bowls hold up well though I use them primarily for cut up avocados, sliced tomatoes, cole slaw, etc. I have used them in the microwave under 15 seconds to reheat toasted English muffins with marmalade with no problem. I use Pyrex glass bowls in the microwave for veggies and soups, so I am unable to speak on how well the bowls hold up with hot foods in the microwave.
I resisted buying and using paper bowls and plates for a long time; however, with my 80th birthday fast approaching, the fewer dishes I have to wash means less time standing on my feet.
I am an experienced shopper, and these quality paper products bought in bulk are the best buy I have found. I recommend them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
★★★★★ 4
My go to.
Size: 50 Count
Nice. Sturdy and good thickness. Nice size. Bought these along with smaller. Leak proof.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
★★★★★ 5
Strong and very convenient
Size: 50 Count
These paper bowls are sturdy and hold up well even with hot or liquid foods. They don’t get soggy easily and are microwave safe, which makes them very convenient. The size is also great for soups, cereal, or leftovers. Good quality for disposable bowls and very practical for everyday use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2026
★★★★★ 5
Sturdy, great value, very utilitarian
Size: 50 Count
Exactly what I wanted. Exact quality thickness and sturdiness. Only small downside is they're coated in a wax like substance and stick together so you have to pry them apart and if you microwave something, it tends to meld together and also stick into the bowl. But I still love them especially the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
★★★★★ 5
Great bowl , great. For water boiling 100%
Size: 50 Count
Finally a microwavable bowl, that doesn't rot when boiling water !!! Yay. Great for oatmeal and soups
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
recommand products
6oz Plain White Hot Drink Cup
30.00
Black cast iron square table base - Medium - Coffee height - 480 mm
119.47
xTune 99-00 BMW 323i/328i Sedan E46 Front Right Power Window Regulator (No Motor) (WR-BM-740-485) - 9939969
40.56
Black Cast Iron Round Step Table Base - Medium - Poseur height - 1080 mm
171.60
Colour Coded Brown Cook's Knives
13.00