SKU: 44075796855

Human IL-17A, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-17A, His tagProduct Specification Species Human Synonyms Cytotoxic T lymphocyte associated antigen 8 (CTLA 8) Accession Q16552 Amino Acid Sequence Protein sequence(Q16552, Gly24 Ala155, with C 10*His) GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 8kDa Actual: 17, 20kDa Purity 95% by SDS PAGE Endotoxin

Product Specification


Species Human
Synonyms Cytotoxic T-lymphocyte-associated antigen 8 (CTLA-8)
Accession Q16552
Amino Acid Sequence

Protein sequence(Q16552, Gly24-Ala155, with C-10*His) GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:16.8kDa Actual:17, 20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

IL-17A is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 44075796855

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Another Floyd
Waukegan, US
★★★★★ 5
Essential kit for those with fetch dogs
Size: 18in, Style: Sport
Now in our 3rd year, my Brittany and I are down to about 40 fetch tosses a day, some 14,600 tosses a year. The Chuck It launcher wears well, so, figure at least 5 years of use, for 73,000 tosses. That makes for a terrific value! There are several key benefits of the Chuck It launchers: One is that you can chuck the ball further than you can throw, which allows you to exercise your dog more easily. The second is that you can pick up and launch the ball without touching it, which means NO slime! And, the Chuck It also gives extra reach when you have to retrieve a ball from sticker brambles. Those are great features for anyone with a fetch dog. If you also happen to have a weak arm or shoulder, the Chuck It launchers provide nice throwing options. I generally throw underhanded. I can't get the full potential range, that way, but, I still get good, long tosses. I curl my second finger above the last bump on the handle, and use a good wrist flick along with arm swing. I've seen others throw side-arm with the Chuck It. I had originally written a second review for the longer 25M Chuck It. Either I, or Amazon messed up, and it looks like I can have only this one review. So, here are my additional thoughts on the 25M: I bought the 25M so that I could throw the ball even further! The good news is, you really can chuck further, with the longer chucker. The bad news is, those longer throws do require more arm and shoulder strength than when using the 18M. This becomes more obvious when you've done 3 or 4 dozen throws. I would recommend the 25M only for those with the youth and/or strength to get the most out of it. Otherwise, I'd say, go with the 18M.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2016
C
Verified Purchase
charles jensen
Grantham, US
★★★★★ 4
Will buy again
Size: 25in, Style: Sport
Fits the bill.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2025
L
Verified Purchase
Liz H.
Phoenix, US
★★★★★ 5
Must Have for Tiring Out Your Pup
Size: 25in, Style: Sport
The Chuckit! Sport 25M Dog Ball Launcher is an absolute must-have for any dog owner with an active pup! This thing takes fetch to a whole new level—effortless long throws, hands-free pickup (no more slobbery tennis balls!), and a comfortable grip that makes playtime easier and way more fun. My dog absolutely loves it, and I love that it helps her burn off energy without tiring out my arm. The included medium ball is the perfect size for medium to large dogs, and the durable construction means it's built to last. If you're looking for a simple but game-changing way to upgrade fetch, this is it. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 13, 2025
A
Verified Purchase
Ann
Cuba, US
★★★★★ 5
My Niece dog loves it!
Size: 18in, Style: Sport
This ball launcher takes a bit of getting. used to, but it is really helpful for those of us who are not MLB pitchers! The launcher itself is a sturdy plastic that is not brittle yet not soft; when the ball is launched there is no destructive bending in the shaft. The handle is padded and ergonomically sound while the cup end cradles the ball but has cut-outs on each side for easy loading and unloading of the ball. It did take a bit of practice for me to get the hang of it, but for my husband and son it was much easier. The launcher works well to help us older, non-gifted athletes launch the ball farther and faster while saving the shoulder, elbow, and wrist (important if there is any arthritis). The ball fits nicely into the cup and releases easily. The 2.5 size was too small for my Doberman, so we opted for the 3.5 in launcher. This smaller launcher and ball are now in the employ of my sister and her husband for their retriever-border collie mix, an 18 month old little fireball!. This is just the right size for her. My sister's husband has difficulty with arthritis and is neither quick on his feet nor able to stand very long. So the launcher comes in very handy. He can actually sit in a lawn chair and throw the ball repeatedly when their dog retrieves and returns it to him. That is a win- win! Top 3 Likes: -Easy to use -Helps older pet owner -Drives the ball farther and faster Top 3 Dislikes: -With repeated uses the edges of the launcher appear to get scuffed and scratched -Some ingrained staining on the edges persists requiring scrubbing to remove -There is a mild worry that with time the launcher may snap
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 4, 2024
R
Verified Purchase
RAWN001
Carnegie, US
★★★★★ 5
My dog loves it
Size: 25in, Style: Sport
I am amazed at how far I can throw a tennis ball. My dog and I absolutely love this. What happens to work well with the squeaky balls?I get on amazon as well. I have one of these at home, And I keep another one in the truck. Very durable, The balls have good bounce, My dog and I have a lot of fun with it. My dog doesn't chew much on balls, But this one seems like it's going to stand out, I love the versatility, Hey can handle almost ending ball that same size. Are you solid rubber bouncy balls, Squeak. Ing tuba balls, Whiffle balls with all the holes in it, Even the squeaky chewing balls. As long as there are that same size. love the product. I've been using them for a few years.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 22, 2024

recommand products