SKU: 44981365653

Human IL-22, his tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-22, his tagProduct Specification Species Human Synonyms Cytokine Zcyto18, IL 10 related T cell derived inducible factor (IL TIF), ILTIF, ZCYTO18 Amino Acid Sequence Protein sequence (Q9GZX6, Ala34 Ile179, with C 10*His) APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACIGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 18. 4 kDa Observed MW: 16.

Product Specification


Species Human
Synonyms Cytokine Zcyto18, IL-10-related T-cell-derived-inducible factor (IL-TIF), ILTIF, ZCYTO18
Amino Acid Sequence

Protein sequence (Q9GZX6, Ala34 - Ile179, with C-10*His) APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 18.4 kDa Observed MW: 16.5, 18-33 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-22 (IL-22) is protein that in humans is encoded by the IL22 gene. IL-22 is an α-helical cytokine. IL-22 binds to a heterodimeric cell surface receptor composed of IL-10R2 and IL-22R1 subunits. IL-22R is expressed on tissue cells, and it is absent on immune cells. IL-22 is produced by several populations of immune cells at a site of inflammation. Producers are αβ T cells classes Th1, Th22 and Th17 along with γδ T cells, NKT, ILC3, neutrophils and macrophages. IL-22 takes effect on non-hematopoietic cells – mainly stromal and epithelial cells. Effects involve stimulation of cell survival, proliferation and synthesis of antimicrobials including S100, Reg3β, Reg3γ and defensins. IL-22 thus participates in both wound healing and in protection against microbes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 44981365653

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Elizabeth Allen
Waukegan, US
★★★★★ 5
Good labels
Size: 1.6“ X 0.8"-White, Color: White
Works great! Can see everything!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026
J
Verified Purchase
Jennifer Ray
Phoenix, US
★★★★★ 5
The only labels I buy again and again.
Size: 1.97'' x 1.18''-White, Color: White
The only labels I use for my thermal printer. Print quality is always perfect. The quality of the sticker is great! Super easy to use just drop them in. Easy to store and organize. Not the cheapest but they don’t stick to my products when removing but they stay on nicely until removal is needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 2, 2025
B
Verified Purchase
Bianka M
Lexington, US
★★★★★ 4
The Hobby Crafter Review: Stick well, clear print, durable, accurate alignment
See below the way I choose the star rating. First I want to say that I am still mad, that the NIIMBOT printer only accepts original NIIMBOT labels, which come at a VERY limited choice, are pricey, and often not even available on Amazon. That being said, those labels work very well, the print is crisp, even the small letters (see picture, the small letters are 1/16"). The ink does not come off, even when rubbed with greasy fingers. I am not able to remove them easily, the adhesion is very good. All prints are centered, even when printing multiple. They align very well in the printer. Which is to be expected at that price! I will buy them again once they are available, because I have no choice, but also because the quality is very good. Star Rating: ***** Exceeds expectations and is better than thought **** Meets expectations and would buy again ***Some minor flaws but ok for the price, would not buy again ** Terrible and I only kept it when the price is right or because of the lack of better alternative *Returned the item because it doesn't work as advertised, is broken, or quality is extremely poor
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 20, 2026
M
Verified Purchase
Mel M
Alexandria, US
★★★★★ 5
20 X 40mm vial labels
Size: 1.6“ X 0.8"-White, Color: White
Works perfectly. Make sure when you’re buying labels that you don’t buy M1/M2 labels unless you have the M1/M2. You need direct transfer unless you have the M series with the fancy color cartridges etc. The “fancy” labels won’t work on normal thermal printers, they need the color cartridges to show up. Anyway this is the 20mm X 40mm size. Perfect for vials. Works in many other non-branded machines.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
D
Verified Purchase
Damian
Boise, US
★★★★★ 5
Great
Size: 1.6“ X 0.8"-White, Color: White
👍🏽
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026

recommand products