SKU: 4658258327

GCGR His Tag Protein, Human

Sale price$612.00 Regular price$680.00
Save 10%

Pay in installments of $170.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GCGR His Tag Protein, HumanProduct Specification Species Human Accession P47871 1 Amino Acid Sequence Ala26 Lys136, with C terminal 8*His AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK GGGSHHHHHHHH Expression System HEK293 Molecular Weight 33 43 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Human
Accession P47871-1
Amino Acid Sequence

Ala26-Lys136, with C-terminal 8*His AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK GGGSHHHHHHHH

Expression System HEK293
Molecular Weight

33-43 kDa(Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

The glucagon receptor (GCGR) is a Class B GPCR that has an important role in maintenance of glucose homeostasis and, as such, is considered to be a valuable target for the treatment of diabetes. The GCGR is widely expressed and can be found in the liver, adipose tissue, heart, kidney, pancreatic islets, stomach, small intestine, thyroid, and skeletal muscle. The GCGR is coupled to the activation of adenylate cyclase via Gs, with concomitant rise in cellular cyclic AMP levels and activation of protein kinase A (PKA). GCGR mRNA has been detected in islets. In vitro/ex vivo studies suggest that glucagon potentiates insulin secretion from isolated islets, although the potency is considerably less than that of the insulin secretagogue GLP-1. Mutations of the GCGR gene are associated with congenital noninsulin-dependent diabetes, and inhibition of GCGR in vivo lowers blood glucose and improves glucose tolerance in obese diabetic mice.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 4658258327

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Karin Conover-Lewis
Fort Morgan, US
★★★★★ 1
Ceramic burr destroyed itself
Color: Silver
For the first two-plus months it worked fine -- the perfect grind and the perfect amount with a full barrel for my oversized coffee mug. I've been using it once daily, more or less, on a medium grind setting of 25, and this morning the ceramic burr started to eat itself. This is not acceptable. Follow up: Circle Joy contacted me and offered to give a full refund on this purchase, which was gratefully accepted. This is outstanding customer service.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
B
Verified Purchase
Brian
Phoenix, US
★★★★★ 5
Best price for better tasting coffee
Color: Silver
I am a coffee snob. I only get beans. I have been using a magic bullet blender to grind, which actually does extremely well, but the grind wasn't quite even enough. So I found the cheapest, ok quality grinder I could and bought this one. I absolutely love it. It take a while to grind, and it only does a little at once, but whatever. This thing works great and my grounds are now even. The burrs seem to be of decent quality and the whole device works smoothly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
D
Verified Purchase
Doc
Massapequa, US
★★★★★ 5
Great price great shoe
Size: 12, Color: Burgundy Polished Full Grain
Excellent shoe. Tried the Sebago penny loafer and the sizing was ridiculous. These J and M are sized perfectly. I’ve had them before and they wear like iron. Very comfortable right out of the box.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
R
Verified Purchase
roger mendes
Chelsea, US
★★★★★ 5
One of the best shoes
Size: 9.5, Color: Black Polished Full Grain
Outstanding. Fashionable, most comfortable and good construction. No sines of use after quite some time. Highly recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
X
Verified Purchase
xyz
Natrona Heights, US
★★★★★ 4
Quality shoe but with a slight squeak.
Size: 10 Wide, Color: Burgundy Polished Full Grain
Nice shoes with the classic Penny Loafer design. Fit was better than another brand I tried. Only reason not 5 starts is disappointment due to a slight squeak at times when walking.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 11, 2025

recommand products